KEGG   Glycine max (soybean): 100806464Help
Entry
100806464         CDS       T01710                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
gmx  Glycine max (soybean)
Pathway
gmx03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100806464
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gmx03041]
    100806464
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100806464
Spliceosome [BR:gmx03041]
 Complex C
  Other components
   Step II factors
    100806464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C OB_NTP_bind IBR DEAD HA2 AAA_22 AAA_19 ResIII zf-C3HC4_2 zf-RING_2 Helicase_RecD zf-RING_UBOX zf-C3HC4 AAA_30 Herpes_ori_bp AAA_29 ABC_tran TrwB_AAD_bind T2SSE Flavi_DEAD DUF2075
Motif
Other DBs
NCBI-GeneID: 100806464
NCBI-ProteinID: XP_003537562
UniProt: I1LNH6
Position
11
AA seq 1736 aa AA seqDB search
MKKATNPNPFSTPRRHDFHRPPPPTHGCGWTPRPVHHRPYHQWRPRFHPHAARIDRPPEP
YFRVELRLGRCPLHRDDVEALIDECRSSHDSFTFYPTDDVAAVLNYRSWEQARDAVVWFW
EARLAEKHDFTPALDSNVVVVKDDVDCRLRPVFARHVKGLMMMEEGKEVKFGMDECERLA
KEISRLSSSLSKPLRIGTQNELMKKKKGLVDEKNLVERRLKEFESAMQCLLKYLEDGGDD
VEGVKVFRFDGGFDWKRIHCLIKRECRRLEDGLPIYAYRRDILQEIHYQQIMVLIGATGS
GKSTQLVQFLADSGVGSDKSIVCTQPRKIAAKAVAQRVQQESSGCYEGQSIKYCSTFLSS
REFDSRITFMTDHSLLQHYMSDNNLSGVSCIIIDEAHERSLNTDFLLTLLKSLLCRRVEM
RLIIMSATADAKQLSDYFFGCGIFHVLGRSFPVDIKYVPSDCGGDSGSAVVASYVSDVVR
MATEIHKTEKEGTILAFLTSQIEVEWACEKFQAASAVALPLHGKLSSDEQFRVFQNYPGK
RKVIFSTNLAETSLTIPGVRYVIDSGVVKDSRFDPSSGMSVLKVCWISQSSADQRAGRAG
RTEPGVCYRMYLEADYQSMDLNTEPEIRKVHLGVAVLRILALGVKDMQDFDFVDAPSPSS
IDMAIRNLIQLGAIELNNNAHDLTSEGWCLVRMGIEPRLGKLILGCFKHGLGREGIILAA
VMANASSIFCRVGSEFDKQRSDCLKVQFCHCDGDLFTLLSVYKEWEALPRERKNKWCWEN
SINAKSIRRCQDTILELETCLEREHDIVTPSYWLWDPCMPSNHDKNLKRVILSSLVENVA
MYSGCNQLGYEVAQTGQHVQLHPSCSLLVFAEKPSWVVFGELLSISNQYLVCVCAFDFQS
LFNLCPAPLFDVSKMEERKLLMKTLSGLGCILLKRFCGKANCDLLALVSRIRKACMDERI
FIEVNVDKNEIHLYATSNEMDIALGLVNGVLEYERKLLRTECMDKFLYHGSGFSPPVALF
GSGAEIKHLELEKRSLSVDVCHPNINEIDDRELLMFFEKNTSGCICAVHKFTGNMRDGDR
DKWGRIIFMSPDVVRRAAELDGQEFCGSSLKIVPSQLGWDKTFSFPAVKARISWPRRLSR
GFAIVKCDIKDVNYILRDFYNLAVGGRYVRCEIGKKSIDSVVINGLDKELSEAEIVDVLR
TATSRRILDFFLVRGDAAGNPPCSALEEALLKEIYPFLPKRNPHIIPCRVQVFAPEPKDS
FMRALITFDGRLHLEAAKALEQIEGKVLPGCLSWQKIKCQQLFHSSIIFPTPVYHVIKEQ
LDEVLASFRNLKGLECNLGRTVNGSHRVKITANATRTVAEVRRPLEELLRGKTIEHDSLT
PVVFQLMLSRDGFSLKNSLQQETGTYILFDRHNLNLRVFGSPNKVALAQEKVIQSLLSLH
EEKQLEIHLRGMDLPPDLMKQMIKNFGPDLRGLKERVPGVDLTLNTRRHIVILHGSKELK
PRVEEIIFEIARSSHHLVERFENGPSCPICLCEVEDGYRLEGCGHLFCRLCLVEQFESAI
NNQGTFPVCCTHRDCGDPILLTDLRSLLFGDKLEDLFRASLGAFVATSGGAYRFCPSPDC
PSIYRVADPESAGEPFVCGSCYSETCTRCHLEYHPYLSCERYQEFKEDPDSSLKEWCRGK
EQVKCCSACGYVIEKVDGCNHVECKCGKHVCWVCLEFFSTSNDCYNHLRTIHLAII
NT seq 5211 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaagctactaatcccaaccccttctccaccccccgccgccacgatttccaccgt
ccgccaccacccacccacggctgcggttggactccccgcccagtccaccaccgtccctac
caccaatggaggccccgattccacccccacgccgcccgcatcgaccgccctccggagcct
tatttcagggtggagctccgcctcggccgctgccccctccaccgcgacgacgtcgaggcc
ctgatcgacgaatgccgctccagccacgacagcttcactttctacccaaccgacgacgtc
gccgccgttctcaactaccggagctgggagcaggcgcgcgatgccgtcgtctggttctgg
gaggcgcggctcgcggagaagcacgatttcacgccggcgttggattccaacgttgtcgtc
gtcaaggacgatgtggattgtcgccttcgaccggttttcgcgaggcacgtgaaagggttg
atgatgatggaagaaggtaaggaggtgaagtttgggatggatgagtgtgaacggttggcg
aaagaaatttctcggctttcgagttcgctgagtaagcccttgcgaattggcacgcaaaac
gagcttatgaagaagaagaaagggctcgttgatgagaagaatctggttgaaaggaggttg
aaggagtttgagtctgcgatgcagtgtttgttgaagtatttggaggatggcggtgatgac
gtggagggtgttaaggtgtttaggtttgatggaggttttgattggaagcggattcactgt
cttatcaaaagggagtgtcggaggcttgaggatgggttgcctatttatgcttaccggagg
gatattcttcaggaaatacattatcagcagataatggtattaattggagcgactggttca
gggaagagtacgcagctggtacagtttcttgctgattcaggcgttggttctgacaaatcc
attgtatgcacccaacctcgcaagattgctgccaaagcagtggctcaaagggtccagcaa
gaaagcagtggatgttatgaaggccaatcaatcaaatattgttctacatttttatcctcg
cgtgagtttgattccaggataacattcatgactgatcattctttattgcagcactacatg
agtgataataatttgtctggggtctcgtgcatcataattgatgaggctcacgagaggagc
ttaaatacagattttctgttgactttgttgaagagtttactttgtaggagggttgaaatg
cggcttatcattatgtctgctacagctgatgcaaagcagctatctgattacttttttggt
tgtggaatttttcatgtgcttgggagaagctttccggtggatatcaaatatgttccttct
gactgtggtggagattctggttctgctgttgttgcgtcatatgtttctgatgttgtcaga
atggcaactgagattcacaaaactgagaaagagggaactattcttgcctttttgacctct
cagatagaagtagaatgggcctgtgaaaagtttcaagctgcctctgcagtagctttgccc
ttgcatggaaaactttcatctgacgagcagttccgtgtttttcagaactaccctggaaag
agaaaagtgatattttcaacaaatcttgcagagacatcacttacaattcctggtgttagg
tatgtgatagattctggggtggttaaagacagcagatttgatcctagcagtgggatgagt
gtacttaaggtttgctggatcagccagagctctgctgatcaacgggctggtcgtgctggg
aggaccgagcctggtgtgtgctatagaatgtacttggaagccgattatcagtctatggac
ctaaatacagagccggagattcggaaagttcatcttggtgtagcagttctgagaatcctt
gctttaggagtgaaggacatgcaagattttgattttgtggatgctccaagtcctagctca
atagatatggcaatccggaatctaattcaattaggagccattgaactgaacaataatgct
catgatttaacttctgaaggttggtgcttggtgagaatgggaattgaacctaggcttggg
aaacttattcttggttgtttcaaacatggtttgggtagggagggtatcatccttgctgct
gtgatggccaatgctagtagcatcttttgcagagttggcagtgaatttgataagcaaaga
tctgattgtcttaaagtgcaattttgccattgtgatggtgacctctttactcttctctct
gtgtacaaggaatgggaagctttgcctcgagaaaggaagaacaaatggtgttgggaaaac
agcatcaatgccaaatccatcaggaggtgtcaagacacaattttggagttagaaacttgc
cttgagcgtgaacatgacattgttactccaagttactggctttgggacccttgtatgccc
tctaatcatgataagaatttgaaaagggtaatactgtcctcacttgttgagaatgtagcc
atgtactctggctgcaatcaacttggttatgaagtggcgcaaactgggcaacatgttcaa
ctacatccatcttgttcattgcttgtatttgctgagaaaccaagttgggtagtttttggt
gagcttctttccatttctaatcaatatttggtctgtgtgtgtgcatttgactttcaatct
ttattcaacctttgccctgctcccttgtttgatgtatccaaaatggaagagcggaagttg
ctaatgaagacactgtctggtctcggctgtattcttctcaagagattttgtggaaaagcc
aactgcgatttgcttgctcttgtttcacgtataaggaaagcttgtatggatgaacgcatc
ttcattgaagtgaatgttgacaagaatgaaatccacttatatgccacttcaaatgagatg
gatatagcccttgggttggttaatggtgttctagaatatgagaggaagttgttacgcacg
gaatgtatggataagtttttgtatcatgggtctggtttctctccacctgtagctttgttt
gggtctggtgctgagataaaacatttggaacttgagaaacgttccttgagtgttgatgtg
tgtcatccaaacataaatgaaattgatgacagggagctcttgatgttttttgagaagaat
acctctggttgcatctgtgctgtgcacaaattcacaggcaatatgagggatggagatagg
gataagtggggcaggataatatttatgtcccctgatgttgtcagaagagctgctgagcta
gatggacaagagttttgtggctcatccttgaaaattgttccttcacagttgggatgggat
aaaacattttcgttccctgctgttaaagcaagaatttcttggcctcgtaggcttagcagg
ggatttgccatagttaaatgtgatataaaggatgtcaattatatcttgagagatttctat
aaccttgcagtaggaggaaggtatgttcgatgtgaaattggcaaaaagagtattgacagc
gttgttataaatgggcttgacaaagagctttcggaagctgaaatagtggatgtgctaaga
actgctacaagtagaaggattttggattttttcttggtgagaggggatgctgctggaaat
ccaccatgcagtgctttggaagaggcactcctaaaagaaatttacccctttttgccgaaa
aggaaccctcacattattccttgccgagttcaggtgtttgcacctgagcctaaggattct
ttcatgagagctttgatcacttttgatggaagattacatttagaggcagcgaaagcattg
gagcaaattgagggaaaggtgttacctggatgtctttcatggcaaaagataaagtgccag
cagttgtttcatagctccattatatttcccactccagtgtatcatgtgattaaggaacaa
ctggatgaagtacttgcaagcttcaggaatttgaaaggtcttgaatgcaacctgggcagg
acagttaatggttctcaccgagtgaagataacggcaaatgccacaaggacagtggcggaa
gttagaagacctctggaagaactattgagagggaaaaccattgagcatgacagcctcacc
cctgtagttttccaactcatgttgtccagggatggctttagtcttaaaaactcattgcag
caagagacgggaacttatattctttttgacagacacaacttaaatttacgggtgtttggt
tccccaaacaaggttgctttggctcaggagaaggtgatacagtccctcctttctctccat
gaagaaaagcagttagaaattcatctgagagggatggatctacctcctgatttaatgaag
caaatgattaagaattttgggccagatctccgtggactgaaagagagggtacctggggta
gatcttacactcaacacacgtcgccatatagtcattcttcatggtagcaaggagttgaaa
ccgagagtagaggaaataatttttgagattgctcgttcaagccatcatttggttgagaga
tttgaaaatggacccagttgcccaatttgcttgtgcgaggttgaggatggataccggctt
gaaggctgtggtcatttgttctgccggttgtgtctggttgagcaatttgaatctgctatt
aataaccaaggcactttcccagtatgttgtactcacagggactgtggagatcccatcctg
cttacagatttgagatctcttttatttggtgataagttggaggatcttttcagggcttct
ttgggagcttttgtggcaacgagtgggggagcttacaggttttgcccttctcctgactgc
ccctcaatttatcgagttgcagatcccgagtctgctggtgagccatttgtttgtgggtct
tgttattcagagacttgtaccaggtgccacttagagtatcatccttacctttcatgtgag
agatatcaagaattcaaggaagatccggactcatctctgaaagagtggtgcagagggaaa
gaacaagttaagtgctgctcggcatgtgggtatgtaattgagaaggtagatgggtgcaac
cacgttgagtgcaagtgcggaaagcatgtctgttgggtttgcttagagttctttagtact
agtaatgactgttataaccatttgagaaccatacacttggccatcatataa

DBGET integrated database retrieval system