KEGG   Glycine max (soybean): 100806571Help
Entry
100806571         CDS       T01710                                 

Definition
(RefSeq) transcription factor bHLH93 isoform X1
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 100806571
NCBI-ProteinID: XP_003517154
UniProt: I1J4X0
Position
1
AA seq 334 aa AA seqDB search
MELSQLGFLDELLAPRKDTTWSNALSTGLNELLLPSGWSFDSFDENQGLATLNPSFAAFS
TPLDHRFECPYGSEAAYPFVDGFTLPELDSSYTRNDESAPLLPQEDNPSLEDEEFGFLGR
DNQSLEQAKIGCKIEEQVTEIPVFNMGLCGEKKPKSKKLEGQPSKNLMAERRRRKRLNDR
LSMLRSIVPKISKMDRTSILGDTIDYMKELLERIGKLQEEEIEEGTNQINLLGISKELKP
NEVMVRNSPKFDVERRDQDTRISICCATKPGLLLSTVNTLEALGLEIHQCVISSFNDFSM
QASCSGAAEQRNCMNQEEIKQALFRNAGYGGRCL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggagctttctcaacttggttttctggatgagctacttgctccaagaaaagacactact
tggagtaatgctttgtcaactgggttgaatgagttactactccctagtggttggagcttt
gactcttttgatgagaaccaaggtttagctactttgaatccctcatttgctgcattttcc
actccactagaccacagatttgaatgcccttatggaagtgaagcagcatacccttttgtt
gatggcttcacattgcctgagcttgattcttcatacaccaggaatgatgagtcagcacca
cttttgccacaagaggataacccatcattggaggatgaagagtttggctttctgggaagg
gataaccagagcttggaacaagcaaaaattggctgcaaaattgaggaacaagtgacagag
attccagtcttcaacatgggcttgtgtggggagaaaaaacccaaatcaaagaaactagaa
gggcagccctcaaagaatctcatggcagaaagaaggagaagaaagcgtttgaatgaccgt
ctttccatgctaaggtcaatagtcccaaagattagcaagatggacaggacctccattctt
ggagacacaattgattacatgaaagagcttctagaaaggataggtaagttgcaagaagaa
gaaatagaggagggaacaaatcagataaacctcttaggcatttctaaggaactaaagccc
aatgaagtaatggttagaaattcccccaagtttgatgttgagagaagagaccaggacaca
aggattagcatctgctgtgccacaaagccaggattactactgtccacagtgaacacctta
gaagcattaggccttgagattcaccagtgtgttataagcagcttcaatgatttttcaatg
caagcatcttgctcaggggcagcagagcagagaaattgtatgaaccaggaagagataaag
caagcactattcagaaatgcaggttatggtggtagatgtctctag

DBGET integrated database retrieval system