KEGG   Glycine max (soybean): 100808400Help
Entry
100808400         CDS       T01710                                 

Definition
(RefSeq) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00260  Glycine, serine and threonine metabolism
gmx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01230  Biosynthesis of amino acids
Module
gmx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100808400
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    100808400
Enzymes [BR:gmx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     100808400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG PcrB NanE Ribul_P_3_epim BtpA NMO FMN_dh TMP-TENI
Motif
Other DBs
NCBI-GeneID: 100808400
NCBI-ProteinID: XP_003521265
UniProt: I1JNY7
Position
3
AA seq 311 aa AA seqDB search
MALALKSSCFLQLKKPEAGFNVCFSSKKAIISVKRHTPVAAIRTMEAVGLSATFTRLKKE
GKVAFIPYVTAGDPDLSTTAEALKVLDSCGSDIIELGVPYSDPLADGPVIQAAATRSLAK
GTNLNAIIDMLKEVVPQLSCPIALFTYYNPILKRGTDKFMSTIRDSGVHGLVVPDVPLEE
TETLRTEAKKHGIELVLLTTPTTPTNRMRAIVDVAEGFVYLVSSVGVTGARASVSGSVQS
LLKEIKEATTKPVAVGFGISKPEHVKQVVVWGADGVIVGSAIVKVLGEAKSPQEGLKELE
VFTRSLKAALP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgccctgaagtcaagttgcttcttgcaattgaagaaacctgaggctggtttc
aatgtttgtttttcatctaagaaagctataatctccgtgaaacgacacactcccgtggct
gctatcaggaccatggaagcagtgggactctctgcaacattcaccaggttgaaaaaagaa
ggaaaagtagctttcatcccgtatgtcactgctggtgatcctgacctttcaaccacagca
gaagcactgaaagtgcttgattcatgtgggtctgacataattgagctaggtgttccatac
tctgatcctttggcagatggtcctgttatccaggctgctgctacaagatctttagcaaag
gggaccaatttgaatgcgattattgatatgttgaaggaggttgttccgcaactgtcatgt
ccaattgcactgtttacatattacaatccaatactgaagcgtggtactgataaatttatg
tccactataagagacagtggtgtacatgggcttgtagtcccagatgtccctctggaggag
acggaaactttaaggacagaagctaagaaacatggaattgaactggtactcctcacaaca
cccacaactccaacaaaccgaatgagagccattgttgatgtggcagaaggatttgtgtat
cttgtgagctcagtgggggtcactggagcccgagcatcagttagtggttctgttcagtct
cttttgaaggaaattaaagaggcaactactaaacctgtggcagttggttttggaatatca
aaacctgagcatgtgaaacaggtagtggtatggggagctgatggtgtgattgttggcagt
gctatagtgaaggtgcttggtgaggccaaatctcctcaagagggattgaaagaacttgaa
gttttcacccgctccttaaaagcggcacttccttaa

DBGET integrated database retrieval system