KEGG   Glycine max (soybean): 100809508Help
Entry
100809508         CDS       T01710                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 2.7
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr WAK_assoc YukC
Motif
Other DBs
NCBI-GeneID: 100809508
NCBI-ProteinID: XP_014627101
Position
19
AA seq 522 aa AA seqDB search
MAFHLLSRPYFMILIITLWSQNSDGSLYPKFEACEPNTCSNNQTISYPFYIEGIQEPFCG
YPGFGLSCGNDGFPFLNMSNAKYMIHQIFYNNSLRVSNAVFSRSNTRSCFPRTPNLTLSD
TRLALAPNQRELFLLFGCDLHEGLQEHIIGCSEENKTGSVVAMNRENQNLGFALMNCKGG
VVNVTVEDEEGGIQEALRRGFLLNWTVSDCNKCKNSGGKCGFDTDIFSFRCYCPHDTHAR
HCSQEKSGNSVVILATDLSIKLEDESLVAVKVLKDLIGFCFEKSKKALVYEFMANGSLEK
FIFETNNLTGDYQLNCEMLYQIAVGVGRGLEYLHRGCKCCTRIFHFDIKPHNILLDENFF
PKISDFGLAKICPRNESVVSMMTARGTIXYIAPEVYCRNIGVVSHKSDVYSYGMMVLEMV
GGRKNINVEVDCTNEIYFPYWIYKRLELNQELALRNVINESDRDIIKKMVLVSLWCIQTD
PSDRPTMHRVVEMLEGNVETIQVPPKPFLSSPSISPRTSPSH
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcattccatttattatcgcgtccatactttatgattctcatcatcaccctttggtca
caaaactctgatggttccctgtacccaaagtttgaagcttgtgaacccaatacatgcagc
aataaccaaactataagctatcctttctacattgaagggatacaagaacccttttgtggg
taccctggttttggcctatcttgtggcaatgatggcttcccatttctcaacatgtctaat
gccaaatacatgatccaccagatattctacaacaactcactacgtgtgtccaatgctgtg
ttttcaagatcaaacactaggagttgttttcctcgtacaccgaacctcactctttcagat
acgagattggctcttgctcccaaccaaagggagctattcttgttgttcggatgtgacctg
catgaagggttgcaagagcacataattgggtgttctgaagagaacaaaaccggttcggtt
gtggccatgaatagggaaaaccaaaacttgggctttgctttgatgaattgcaagggtggg
gtggtgaatgtgacggtggaagatgaagaaggagggattcaagaagcactgagaagaggg
tttttgttgaattggactgtcagtgattgcaacaagtgcaaaaacagtggagggaagtgt
gggtttgacactgacatattcagtttcagatgttactgccctcatgatactcatgctcga
cattgttcccaagaaaaatccggaaattcggttgttatactagcaacagacttatcaata
aagttagaagacgaatctctagttgctgtcaaggtcttgaaagatcttattggattttgt
tttgaaaaatccaagaaagctctagtctatgagttcatggctaatgggtctctagagaaa
tttatatttgagactaataacttgacaggtgattaccaattgaattgtgaaatgttatat
caaattgcagttggtgttggtcgaggactagagtacttgcatagaggatgcaagtgttgt
acacgaatatttcattttgacataaagcctcacaacatactgctggatgagaattttttc
ccaaagatctcagattttggacttgctaaaatatgccctagaaatgagagtgttgtgtct
atgatgactgctagaggaactatatgatatattgctcctgaggtgtattgtagaaatatt
ggagttgtatctcacaagtcggatgtttacagttatggaatgatggtgttagaaatggtg
gggggaagaaagaatattaatgttgaagttgattgcacaaatgaaatatattttccttat
tggatttacaagcgtttggaactaaaccaagagcttgcactgaggaatgttattaatgaa
agtgacagagacatcataaaaaagatggtactagtaagtttgtggtgtatacaaactgac
ccttcagaccgtccaacaatgcatagggtggtagagatgcttgaagggaatgttgaaacc
atacaagtaccaccaaaacctttcttatcatccccttcaatatcaccacgcacatctccc
tctcattga

DBGET integrated database retrieval system