KEGG   Glycine max (soybean): 100809656Help
Entry
100809656         CDS       T01710                                 

Definition
(RefSeq) glutamate--tRNA ligase, cytoplasmic
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00860  Porphyrin and chlorophyll metabolism
gmx00970  Aminoacyl-tRNA biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Module
gmx_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100809656
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100809656
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gmx01007]
    100809656
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gmx03016]
    100809656
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:gmx02048]
    100809656
Enzymes [BR:gmx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     100809656
Amino acid related enzymes [BR:gmx01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   100809656
Transfer RNA biogenesis [BR:gmx03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100809656
 Prokaryotic Type
   Other AARSs
    100809656
Prokaryotic defense system [BR:gmx02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    100809656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C GST_C GST_C_3 tRNA-synt_1e GST_C_2
Motif
Other DBs
NCBI-GeneID: 100809656
NCBI-ProteinID: XP_003536004
UniProt: I1LAX4
Position
10
AA seq 733 aa AA seqDB search
MDIKTFAFAPSSPPLPVIAAAKLAGISPSIDTSLSPDSPPAFIFSDGLKLHGAYALLRYI
GRVASLPNFYGQNALESSQIDEWLDYAPILSSGPAFENACKYIDEYLEKCTFLVGYSLSI
ADLAIWAGLAGSGKRWESLRKSKKYPNLARWFNSIVAEHGTVLNEVTSVYAGKKGLGEPT
ATKSKDQSVNTDKVKKVNGDVSENNKGGSKPSAEIDLPDAEVGKVRLRFAPEPSGYLHIG
HSKAALLNKYFAERYKGQVIVRFDDTNPAKESNEFVDNLIKDIDTLGIKYEQITYTSDYF
PELMEMAEKLIRQGKAYVDDTPREQMQKERMDGIDSKCRNNSVEENLKLWKEMIAGTERG
LQCCVRGKLDMQDPNKSLRDPVYYRCNPMPHHRIGSKYKVYPTYDFACPYVDSIEGITHA
LRSSEYHDRNAQYYWIQEDMGLRKVLIYEFSRLNMVYTLLSKRKLLWFVQNGKVDGWDDA
RFPTVQGIVRRGLKIEALIQFIVEQGASKNLNLMEWDKLWTINKKIIDPVCPRHTAVIAD
RRVLLTLTDGPEKPFVRIIPRHKKYEAAGDKATTYTKRIWLDLADAVSLSAGEEVTLMDW
GNAIVKEIEKDQDGNIIGLSGVLHLEGSVKTTKLKLTWLPEIDELVSLTLVEFDYLITKK
KLEEGEDFIDVVNPCTKKETLAYGDSNMRNLQRGDLLQLERKGYFRCDLPFIRPSQPIVL
YAIPDGRQQTSLK
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaaaacctttgctttcgccccatcttctccgccgttaccggtaatcgccgcc
gccaagctcgccggaatctctccctcgattgatacctctctctctcctgactcacctccc
gcatttatcttctccgatgggctcaagttgcatggagcatatgctcttctacgttatatc
ggccgagttgccagccttcccaatttctatgggcaaaatgcattagaatctagccagatt
gatgaatggctggactatgctcctatcctctcatctggccctgcttttgagaatgcatgc
aaatatatagatgagtacctggagaagtgtacttttttggttggttattcattgtcaatt
gcagacctagcaatctgggcaggtcttgcaggttctggaaagagatgggaaagtctaagg
aagtcaaagaaatatccaaatcttgcacggtggttcaattcaatagtggcagaacatggt
actgtgttaaatgaagtcacatcagtgtatgctggcaaaaaaggattgggagaaccaaca
gcaaccaagtcaaaagaccagtcagtaaacactgataaagtgaagaaggtgaatggggat
gtatctgagaacaacaaaggaggaagcaaaccatcagcagaaatagatcttccagatgct
gaagttggaaaagttcgcttgcgatttgcccctgaaccaagtggttatcttcatattgga
cactcaaaagcagctttgttgaacaaatattttgctgagcgatacaagggtcaggttatt
gtgcgttttgatgataccaatcctgctaaagaaagcaatgaatttgtggacaaccttatt
aaagatattgatacattgggtatcaaatatgaacaaattacatatacgtcagattacttc
cctgagttgatggagatggctgaaaaattaattcgccagggtaaagcatatgttgatgac
acaccacgtgaacaaatgcaaaaagagagaatggatggcatagattctaaatgcagaaat
aatagtgtagaggagaatctaaaattgtggaaggaaatgattgcaggaacagagaggggc
ttgcagtgttgtgtccgtggcaagttggatatgcaggacccaaacaaatcacttagagat
cctgtttattatcgttgcaatccaatgccccatcatagaattggatccaagtataaagtg
tatccaacttatgattttgcttgtccatatgttgattctatagaaggaatcacgcatgcc
cttcgatctagtgaataccatgatcgcaatgcccagtattactggattcaagaggacatg
ggtcttagaaaagttcttatctacgaatttagccggttgaatatggtctacactcttctg
agcaaacgaaagcttttgtggtttgtacaaaatgggaaagttgatggatgggatgatgca
cgatttcctacagtgcaaggaattgtgcgtagaggtttgaaaattgaagccctgatacag
tttattgttgagcagggggcgtccaaaaatctcaatctcatggaatgggacaagctctgg
accattaataagaagattattgaccctgtctgtcctagacacactgctgtcattgcagac
agacgtgttttgttgactctcactgatggtcctgagaaaccttttgtccgcatcatacct
cggcacaagaaatatgaagctgccggagataaagctacaacatatactaaaaggatatgg
cttgaccttgctgatgcagtgtctttatcagcaggtgaggaagtaacattgatggattgg
ggaaatgccatagtgaaggaaatagagaaggaccaagatggaaatatcatagggttgagt
ggtgttttgcatcttgaaggatctgtgaagaccacaaaattgaaactcacttggctacct
gagatagatgaactagttagcctgacattagtggagtttgattatctaattacaaagaaa
aagcttgaagaaggggaggatttcattgatgtggttaacccatgtaccaaaaaggagact
ttagcttatggagactccaacatgcgaaatcttcagcgtggagatttattgcaactggag
agaaagggatatttcaggtgtgatttacccttcattcgcccctcacaaccaatcgtgcta
tatgcaatccctgatggcaggcaacagacaagtttgaagtaa

DBGET integrated database retrieval system