KEGG   Glycine max (soybean): 100810938Help
Entry
100810938         CDS       T01710                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme 1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00052  Galactose metabolism
gmx00500  Starch and sucrose metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100810938
   00500 Starch and sucrose metabolism
    100810938
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100810938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 100810938
NCBI-ProteinID: XP_003556736
UniProt: K7N124
Position
20
AA seq 555 aa AA seqDB search
MALPSTKMPVVFYSMVLLIINNCIEAVSVRGDYHRTGFHFQPLKNWMNDPNGPMYYNGVY
HLFYQYNPNGTVWGNIVWAHSVSKDLINWNGIEHAIYPSKPFDKFGCWSGSATIIPGKGP
VILYTGVIDENNTQVQCYAEPEDPNDPLLRRWVKPDKLNPAVVDKDVNHTEFRDPTTAWW
GKDGHWRMLVGSVRKRRGIAYLYRSKDFKTWVRAKHPIHSKGGTGMWECPDFYPVSVIGN
VVGNPVKHVLKNSLDDTKFDYYTVGTYLEDKDRYVPDNTSVDGWGGLRYDYGNFYASKSF
FDPSKNRRILWGWANECDKPIDNFRKGWAGIQAIPRTVWLDFTGRQLVQWPVEELNSLRG
KEVNIDNQRLEKGDYSEVKGITAAQADVEVTFSFSSLDKAEAYDPKWVKAQDLCAQKGSK
LQGGVGPFGLLTLASQNLEEFTPVFFRVFKSPNKHIVLLCSDARSSSLKSDLYKPQFAGF
VDVDLAADKKISLRSLIDHSVVESFGAGGKTNILSRVYPELAVMNQAHLFVFNNGTEPIV
VQNLKAWSMISADIK
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggctctcccaagcaccaagatgcctgtggtgttttactccatggtgttgctgatcatc
aacaattgcattgaagcagtttcggtgagaggagattatcacagaactggattccatttc
cagccccttaaaaactggatgaacgatccaaatgggccaatgtactacaatggagtatac
catctgttctaccagtacaatcccaatggcacagtgtggggtaacatagtgtgggcgcac
tcagtgtccaaggatctgataaactggaatggcattgaacatgctatttatccatcaaag
ccctttgacaaatttggctgctggtcagggtctgctaccataatccctggtaaggggccc
gtgatcctctacactggagttatagacgaaaataacactcaagtgcaatgctatgccgaa
ccagaagacccaaatgacccacttcttcggagatgggtgaaaccagacaagctcaaccca
gctgtggtagataaagatgttaaccacactgaatttcgtgaccccacaacagcttggtgg
ggcaaggacggtcactggaggatgctggtgggcagtgtaaggaagcgcagaggaatagct
tatctatacaggagcaaggacttcaagacatgggttcgggccaaacaccctatccattcc
aagggtggtacgggtatgtgggagtgccccgacttttacccagtttcagttataggaaat
gtagtggggaatccagtgaaacatgtgttgaagaacagccttgatgatactaagttcgat
tactatactgtggggacctatctggaggataaggataggtatgtgcctgacaacacttca
gtggatggttggggtggacttaggtatgattatggcaacttctatgcttccaaatcattt
tttgaccccagcaagaacaggaggatcttatggggttgggcaaacgagtgtgataaaccg
atagacaattttcggaaaggatgggcaggaattcaggcaattccacgaactgtgtggctc
gattttactgggagacaattggtgcaatggcctgttgaagagttaaacagtctcagaggc
aaagaagttaacatagacaatcaaaggcttgagaagggagattatagtgaagtaaaagga
atcactgctgcccaggcagatgttgaagttacgttctccttttcaagcttggacaaggca
gaggcatatgatcctaagtgggtaaaggcgcaggatctatgtgcccaaaagggttcaaaa
ctacagggtggggttggaccgtttggacttctgactttggcttctcaaaatctcgaagag
ttcactcctgtgtttttcagagttttcaaaagtccaaataagcatattgttctcttatgc
tctgatgcgagaagttcatctttgaagagtgatctgtacaaaccacaatttgctgggttt
gtagatgtggatttggccgcggataagaagatttctcttaggagtttgattgatcactca
gttgtggagagttttggagcaggagggaagacaaacattttgtcccgagtctatcccgag
ctagcagtgatgaaccaagcgcacttgtttgtgttcaacaatggtactgaaccaatcgta
gtgcaaaacctcaaagcttggagcatgatatctgctgatataaaatga

DBGET integrated database retrieval system