KEGG   Glycine max (soybean): 100811075Help
Entry
100811075         CDS       T01710                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase 4, chloroplastic isoform X1
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00030  Pentose phosphate pathway
gmx00480  Glutathione metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01200  Carbon metabolism
Module
gmx_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
gmx_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100811075
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100811075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gmx04147]
    100811075
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     100811075
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     100811075
Exosome [BR:gmx04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100811075
  Exosomal proteins of colorectal cancer cells
   100811075
  Exosomal proteins of bladder cancer cells
   100811075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 100811075
NCBI-ProteinID: XP_003520786
UniProt: I1JR33
Position
3
AA seq 612 aa AA seqDB search
MSVSFSSTSVSFSESSFAFQRPAPAHLCSNSLTVASNNFHSATGGGRLVLNVGGTCLCRK
FRGLKLWLLERLSFQFQPPKQPKNRNHHFRNNLENEKGSVSDSSSNLRVPDDKVTPVESL
SLLQTGLSGTPVDVGRKPSLCIAVIGATGELAKRKIFPALFALYYSGFLPENVGIFGYSR
KDITDEDLRSIIASTLTCRVDHQENCDNKLDAFLSKTYYINGGYDNKYGMSMLNSRMEQI
EGGSKTNRIFYLSVPQEALLDVASCLASSAQTQNGWNRIIFEKPFGFDARSSDRLTQYIL
SNFQEKQIFRIDHLLGRNLIENLTVLRFSNLVFEPLWSRTYIDNVQVILSEDLGVHPGRY
FSGYGIIRDIVHCHVLQTIALLAMEPPISLDGEDIRNEKLKVLRLIRKLEPKDVILGQYK
ASGGAKVDACVNGLTPTYFAAALYIDNARWDGVPFLIKTGLGLIKHQMEIRIQFRNVPGN
VYHECIGHNRDRAINELILRDVPDEAILVRVNNKVPGLGLQLDSSELNLLYKDKYNMEVP
DSYEHLLLDVIDGDNHLFMRSDELAAAWTILTPILNEIDKNNMSVELYEMGGRGPIGAYY
LWAKHGVRWVED
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgtctttctcttcaacctcggtttcgttctcggaatcctcatttgcattccaa
agacctgctccagcacatctttgctcaaattcactcaccgttgcatcgaacaactttcat
tcagcaacaggtggtggtcgtcttgtgctgaatgttggaggcacctgcttgtgtcgaaag
tttcgtggtttgaaactgtggctacttgagagactcagcttccaattccagccaccaaag
caacctaagaatagaaaccatcacttcaggaataatttggaaaatgaaaagggatcggtt
tctgattcatcttcaaatcttcgtgttcctgatgataaggtcactccggtggagtctcta
tcgttgctgcagacaggtttgtctggtactcccgtggatgttggcagaaagccctcactt
tgtattgctgtcataggagccaccggtgagctggcaaagaggaagattttccctgctttg
tttgccctctactacagtggctttcttcccgagaatgtaggcatttttggttattcaagg
aaggatataactgatgaagacctgcgatctattatagcttcaacattaacatgccgagtt
gatcatcaagaaaattgtgacaacaaattagatgctttccttagtaaaacatattacatt
aatggaggctatgacaataaatatgggatgtccatgctgaattctcgaatggagcaaatt
gagggaggatccaaaaccaacaggatattctacctttctgtgccacaagaagcacttttg
gatgttgcttcatgccttgcaagcagtgctcagacccagaatggatggaatcgcataata
tttgagaagccatttggctttgatgcacgttcttccgataggctgacacaatatattctt
tcaaactttcaggaaaagcaaatatttaggattgatcatctactaggaaggaatctcatt
gaaaatcttacagttttaaggttttcaaatctagtttttgagccactttggagtcgtact
tacatagataatgtacaggtcattttatcagaggacttgggtgtgcatccaggaagatat
ttcagtggctacggaattatccgtgatattgttcactgtcatgtgctccaaacaattgca
ttgcttgccatggaaccaccaataagccttgatggagaagatattagaaatgaaaagctc
aaggttttgaggttaattcgcaaattggagccgaaggatgtcattcttggccaatataaa
gcaagtggtggagccaaagttgatgcatgcgtaaatggtctgacacctacttattttgct
gctgcactatacattgacaatgcacgatgggatggtgtgccatttctgattaaaacaggc
ttggggctcatcaaacaccaaatggagattcggattcaatttcgcaatgttccggggaat
gtataccatgagtgcatcgggcataacagggaccgtgccataaatgaactcattcttcgg
gatgttcctgatgaagctattttggtgagagtgaacaataaggttccaggactaggcctg
caactggactcttcagaattaaatttgctttacaaggacaagtacaacatggaggtgccg
gattcatacgagcatcttcttctggatgtcattgatggagacaaccatttgtttatgaga
agtgatgagttggcagcagcgtggaccattctaactccaattctgaatgagatagacaag
aacaatatgtcagtggagctttatgagatggggggtcgcggtcctattggggcatactac
ctctgggcgaaacatggtgtccgttgggtggaggattaa

DBGET integrated database retrieval system