KEGG   Glycine max (soybean): 100813959Help
Entry
100813959         CDS       T01710                                 

Definition
(RefSeq) GPI transamidase component PIG-T isoform X1
  KO
K05292  GPI-anchor transamidase subunit T
Organism
gmx  Glycine max (soybean)
Pathway
gmx00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    100813959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 100813959
NCBI-ProteinID: XP_003522098
UniProt: I1JLJ1
Position
3
AA seq 704 aa AA seqDB search
MRRGHRHTHCKCVSNFNGEISVVTVKSLTTANFQRQRKRLQSMALPPLCILLFLVFLLSA
TSTQQEEEFTEELLLKPLPDRKVLAHFHFQSDSPPLAAADESSSFDRHHHLFPKSISQLV
QKYHIKAMELSFTQGRWNYERWGGFDSISSCNAKPPGVELWAVFDVPPHQVDASWKNLTH
SLSGLFCASINFLESSTTYSAPEWAFQSALGSLRYGTLPREAVCTENLTPWLKLLPCRDK
AGLSYLMDRPSIYRSFYHSQRLHLTMSTDPSDGSRSGIILEQTLTVVVQPSEQKAGMNHV
SETKIQPSWSMSSIFGRKISGRCVLAKLSNVYLHAERGLVSQLENLQKNTAKFAANDTGP
EDFRRNAGFELSVTPERVHAELEKSSSILYEYPIKEYTDTEQFDLGLMWKHPIVWSSPHG
PLYASRFLMGSGNERGAIAISLKSTPGLVAANNVEERCKLKVNVLQIVPWYVKVYYHTLQ
LVVDERPQALTDFVERMRVSPSLDKVSPGVMEMALQFPCEMKSAVLSIEFDKGFLHIDEY
PPDANQGFDIPSAIISFPDFHAGLQFSDKSQSKSPLLSKLQEKSPVLSYTEVLLVPLTTP
DFSMPYNVITITCTVFALYFGSLLNVLQRRVGEEERLLKDKVANKAVFLRRVLSKLSAKL
RGRSLELTPPAPSWSSSSSFVTPKLILRVLVVAGIAFAWQYYSQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgaggagggggcacagacacacacactgcaagtgcgtttccaatttcaatggtgaaatc
tctgtagtgacagtgaagtcactcactactgcaaattttcaaaggcagcgaaagagactc
caatcaatggctcttcctcctctctgtattcttcttttcctcgtctttctgttatcagca
acatcaacacaacaagaagaagagttcacggaggagttgctgctgaagcccttgcccgat
cgcaaggttctcgcgcatttccacttccaaagcgattctcctcctctcgccgccgctgat
gagtcctcctccttcgatcgtcaccaccacctctttcccaaatctatttctcagctggtt
cagaagtatcatattaaagcaatggagttatcttttacacaaggtcgatggaactatgaa
agatggggtgggtttgattcaatatcaagctgcaatgcaaagcctccaggagttgaattg
tgggcagtttttgatgttcctccacatcaggttgacgcttcttggaaaaatttaacccat
tcactatcaggtctcttttgtgcttcaatcaacttcctggagtcttctaccacttattct
gctcctgaatgggcatttcaatcagctttgggcagtttaagatatggtacactgccacgt
gaagctgtgtgcactgagaatcttaccccttggttgaaactccttccttgtcgagataaa
gctggactctcttacttaatggatagaccatctatttacagaagtttttaccactctcag
cggttgcacttgacaatgtccacagatccttcagatgggtcaagatcaggaattattcta
gaacaaacacttacagttgtagtccagcctagtgaacagaaagctggtatgaaccatgtc
agtgaaacaaagattcaaccaagctggtcgatgagttcaatatttggaagaaaaatcagt
ggaagatgtgttcttgccaagttgagtaatgtttaccttcatgctgagagaggtctagtc
tctcaacttgagaatctccagaagaataccgctaaatttgctgctaatgacacaggtcct
gaagattttagaaggaatgctggctttgaattatctgttactcctgaaagggtgcatgca
gaactggaaaagagctcctcaattctgtatgaatatccaatcaaagaatacacagacact
gaacaatttgatttaggcctaatgtggaagcatccaattgtttggtctagcccacatgga
cctttatatgccagtagatttttgatgggaagtgggaatgaaaggggtgctattgcaata
tccttgaaatcaaccccgggacttgttgcagccaataatgttgaagagaggtgtaagttg
aaagttaatgttctccaaattgtgccttggtatgttaaggtttattatcatactttgcaa
ttagtagttgatgaaaggcctcaagccctcacagattttgttgagagaatgcgtgtttca
ccttccctagacaaagtatcacctggggtgatggagatggctctccaatttccttgtgaa
atgaagtcagctgtattgagcatagagtttgataagggcttcttacacattgatgaatac
cctccagatgctaatcaaggatttgacattccatcagcaataataagctttcctgacttc
catgctggtttgcaattttctgataaatctcaaagcaagtcaccactgttgtctaaatta
caggaaaagagtcctgttctctcttacacagaagttttacttgtacccttgacgacacct
gatttcagtatgccatataatgtcatcacaatcacatgcacagtttttgcattgtatttt
ggatctttgctaaatgttctccaaagacgagttggagaggaagaaagacttttgaaagat
aaagttgcaaacaaagcagtgttccttcgtcgagtactatctaaactatctgccaagctt
agaggcagatcgttggaattgactccaccagctccctcgtggtcatcatcatcgtccttt
gttactccaaaattgattcttagagtactagtggttgcaggaattgcctttgcatggcaa
tactattcacaatga

DBGET integrated database retrieval system