KEGG   Glycine max (soybean): 100814788Help
Entry
100814788         CDS       T01710                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00052  Galactose metabolism
gmx00500  Starch and sucrose metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100814788
   00500 Starch and sucrose metabolism
    100814788
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     100814788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 100814788
NCBI-ProteinID: XP_003533514
UniProt: K7LFL4
Position
9
AA seq 630 aa AA seqDB search
MAAMNPDLEHAPQIPLLNPPTGESGRRTQKGTLVFIVSIVFLLSFIIINLQSHEPSFENN
ITTVPLLPIARGVAEGVSAKSNPYLSQKASYNWTNAMLSWQRTAFHFQPQRNWMNDPNGP
LFYMGWYHIFYQYNPDSAVWGNITWGHAVSRDLIHWLYLPIALVPDKWFDISGVWSGSAT
LLPDGKILMLYTGNTDRNVQVQNLAYPANLSDPLLLDWVKYANNPVLVPPPGIGPKDFRD
PTTAWIGPDEKWRITIGSKLNKTGLSLLYKTQDFIHYEQSDRYLHQVPGTGMWECVDFYP
VSVNGPNGLDTSENGPDVKHVLKASLDDTKVDHYAIGTYFIENDTWVPDNPNEDVGIGLK
LDYGRYYASKTFYDQQKQRRILWGWINESDSETADLKKGWASLQTIPRTVVFDKKTRTNL
LHWPVEEVESLRLSNSEFEGVVVKPGSVVPLDIGPATQLDIFAEFEIEDLASKGIGKDNV
DCGNGAVDRSAFGPFGILAIADDQLSELTPIYFHLSSTTKDGSLTTSFCVDETRSSKAPD
VSKLIFGSKAPVLSDEKLSMRVLVDHSIIESFAQGGRTVITSRVYPTEAIYGAARLFLFN
NATDINIKASLKIWQLNSAFIRPFPFDQKL
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggcagccatgaaccctgatcttgagcatgctccacaaattcccttgctgaatcctcca
acaggggaaagtggaaggagaacgcaaaagggtacccttgttttcattgtctcgattgtt
ttcctattgtcatttatcatcataaaccttcagagccatgagcccagctttgaaaacaat
atcacaacggtgccattactacctatagctagaggggtcgctgagggtgtatcagccaag
tcaaatccatatctatcacagaaagcttcatataattggacaaatgccatgttatcttgg
caaagaacagctttccattttcaacctcaaaggaactggatgaacgatcctaacggtcca
ttgttttacatggggtggtaccatatattttaccaatacaatcctgattcagcagtgtgg
ggcaacataacatggggccacgctgtatccagagacttgattcactggctctaccttccc
attgcgttggttccagataagtggtttgacatcagtggtgtatggtcagggtcagcaacc
cttttgccagatggcaaaatcctaatgctctacacgggtaacaccgatcgaaacgtgcaa
gtccaaaatcttgcgtaccccgccaacctatctgatcccctcctccttgattgggtcaaa
tacgctaataaccccgtcttggtgcccccaccaggcattgggccaaaggattttcgtgac
ccaaccactgcgtggattgggccagatgagaagtggaggatcactattgggtcaaagctc
aacaagacaggtctttcgttgctttataaaacccaagatttcatccactatgagcaaagt
gatcgctatttgcatcaagtcccgggtaccggcatgtgggagtgcgttgacttttacccg
gtttcagtaaacgggcctaacggtttggatacatctgaaaatgggccagatgtgaagcat
gtgttgaaggctagtttggatgacactaaggtggatcattatgcaattggaacctacttc
attgaaaatgatacatgggtgcccgataacccgaatgaggatgtgggtatcgggttgaaa
ttggactatgggagatactatgcgtcaaagacattctatgaccaacaaaaacaaagaagg
atcctgtggggttggattaatgaatcagatagtgaaaccgctgacttgaaaaagggttgg
gcatctctccagactattccaagaacagttgtgtttgacaagaagactagaactaatttg
cttcactggccagtggaagaagtagaaagcttaagacttagcaactccgaatttgaagga
gttgtggttaaacctggctcagttgtgccactggacataggcccggccacacagttggac
atatttgctgaatttgaaatcgaagatttagcatccaaaggaattggcaaggacaatgta
gactgtggaaatggagctgttgacagaagtgcttttggaccattcggtattttggctatt
gcagatgaccaactttctgaactaacaccaatttatttccatctttctagtactactaaa
gatggcagtttaaccacttccttctgtgttgatgaaactaggtcatcaaaggctcctgat
gtttcaaagctcatttttggaagcaaagctccagttctcagtgatgaaaaattatcaatg
agggtattggtcgaccattctatcattgagagctttgctcagggagggagaacagtgatc
acatctagagtttatccaacagaagcaatatatggagctgcaagattgtttctgttcaac
aacgcgacggacataaacatcaaggcctcgctcaagatttggcaattgaactcagctttc
atacgccccttcccctttgaccagaagttgtga

DBGET integrated database retrieval system