KEGG   Glycine max (soybean): 100815345Help
Entry
100815345         CDS       T01710                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
gmx  Glycine max (soybean)
Pathway
gmx03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100815345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gmx03041]
    100815345
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100815345
Spliceosome [BR:gmx03041]
 Complex C
  Other components
   Step II factors
    100815345
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_30 T2SSE AAA_19 PhoH DUF2075 AAA_25 AAA_23 ABC_tran
Motif
Other DBs
NCBI-GeneID: 100815345
NCBI-ProteinID: XP_003520120
UniProt: K7K7U5
Position
2
AA seq 705 aa AA seqDB search
MPSVPRGNFSNRQTQFSERRQKIIQQRKSLPITPVEKRLVEEVRKHDVLIIVGETGSGKT
TQIPQFLFDAGFCRDGRVIGITQPRRVAAVTVAKRVAEECGVELGQKVGYSVRFDDATSG
STRIKYMTDGLLLREALLDPYLSKYSVIIVDEAHERTVHTDVLMGLLKNVQLARSSSVSG
GQGLIFGNKNMNKLLEKENDQSGSFLKKPHHEKYAPLKLIIMSASLDARAFSEYFGGAKA
VHIQGRQFPVDIFYTRDAETDYLDASLITIFQIHLEEGPGDILVFLTGQEEIESVERLIN
EKLPQLPQENQKLLVVSIFAALPSEQQMRVFAPAPSGFRKVILATNIAETSVTIPGIKYV
IDPGFVKARSYDPGKGMESLIIIPASKSQALQRSGRAGREGPGKCFRLYPEREFEKLEDS
TMPEIKRCNLSNVILQLKALGVDDILGFDFIEKPSRAAIIKSLEQLFLLGALTDECQLSD
PVGHQMARLPLDPLYSKALILASQFNCLEEMLITVALLSVESIFYSPRDKLEEARTATKC
FSSPEGDHITLINVYRASNDFLEKRSMEMNTAKTEKVYRKWCKENFINSRSLRHARDIHR
QIQGHVEQMGLNLSSCGDDMLQFRRCLAASFFLNAAVKQPDGTYRTLASGQVVQIHPSSV
LFRQKPECVIFNELVQTNNKYVRNLTRVDYLWLTELAPQYYAMHN
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagtgccacggggaaacttctccaatcgccaaacccaattctccgagcggagg
cagaagattatacaacagaggaagtctcttccgattacaccagttgagaaaaggctggtt
gaagaggttcggaagcacgatgtgttgattattgttggcgaaactggaagtggaaagact
actcagattccgcagtttctgtttgatgctggattttgccgcgatggaagggttattggg
ataacgcaacctagacgtgtggctgctgtcactgtggcaaaacgtgttgctgaggagtgt
ggtgttgagttgggccagaaggtcgggtattcggttagatttgatgacgctacttccggt
tcaacaaggatcaaatatatgacagatgggttgcttttgagggaagcattgttggatcca
tatctttctaagtattctgttataattgttgatgaagcacatgagaggactgttcacact
gatgtcttgatgggcttgctaaaaaatgtacaacttgctcggtcaagttctgtaagtggt
ggtcagggccttatttttggaaacaagaatatgaataagttgttggagaaagaaaatgat
caaagtggcagttttcttaaaaagccccaccatgagaagtatgctccattgaagttaatt
atcatgtctgctagtcttgatgcacgtgctttctctgagtactttggtggtgccaaagct
gttcacatccaagggagacagtttcctgtagatatattttatacccgtgatgcagagaca
gattatttagatgcttccttgataacaatattccagattcatttagaggagggccctggt
gatatactagtatttctgactggtcaagaagagattgaatctgttgaaaggcttatcaat
gagaaactcccacaattaccacaagaaaatcagaagcttctagttgtgtctatatttgca
gctcttccatctgagcagcaaatgcgggtctttgcaccagctccatctgggtttcggaag
gtgatattggcaactaatattgcggagacatcagtaacaattcctggaatcaagtatgta
attgatcctggatttgttaaagcacgttcttatgaccctggcaaaggcatggaatccttg
attataatacctgcatccaagtcccaagctctgcaaagaagtgggcgtgcagggcgtgaa
ggacctggaaaatgcttccgtttatatccagaaagagaatttgagaaacttgaggattca
acaatgccagagattaagcgctgcaacctttctaatgtcattttacagcttaaggctttg
ggtgttgatgacatactagggtttgatttcattgagaaaccttcaagggcagctattata
aaatcattggagcagctatttttgctaggtgctctaacagatgaatgtcaactatctgat
cctgttgggcatcaaatggctagactgcccttggaccctctttattcgaaagctcttatt
ttagctagtcagtttaactgcttggaggagatgttgataactgtggcactgctgtctgtg
gaatccatattttatagtcctcgtgacaagctagaagaggcaagaactgcaacgaaatgc
ttctcaagtccagagggagaccacatcactttgataaatgtgtatcgagcatctaatgat
ttcttggagaagagatcaatggaaatgaatacggcaaagactgaaaaggtttatagaaaa
tggtgcaaagaaaattttattaatagccggtctcttagacatgctcgtgacattcacagg
cagattcagggacatgttgaacaaatgggtctgaatctttcttcttgtggagatgatatg
cttcaattccggagatgccttgcagcttctttcttcctcaatgcagctgtaaagcagcca
gatgggacatacaggactttggcaagcggtcaggtggtgcagatccacccttcttctgta
ttattccggcaaaaaccagagtgtgtgatatttaacgaattggtccaaactaataacaag
tatgtccggaatttaaccagagttgattacctatggttaaccgagctggctcctcaatat
tatgctatgcacaattaa

DBGET integrated database retrieval system