KEGG   Glycine max (soybean): 100815457Help
Entry
100815457         CDS       T01710                                 

Definition
(RefSeq) probable protein S-acyltransferase 22
  KO
K20027  palmitoyltransferase ZDHHC1/11 [EC:2.3.1.225]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gmx04131]
    100815457
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     100815457
Membrane trafficking [BR:gmx04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100815457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC MARVEL DUF2755
Motif
Other DBs
NCBI-GeneID: 100815457
NCBI-ProteinID: XP_003529465
UniProt: I1KME9
Position
7
AA seq 623 aa AA seqDB search
MRKHGWQLPYHPLQVVAVAVFLALGFAFYVFFAPFVGKKMYQYIVTGLYSQLIISVFGLY
IWCAAADPADPGVFKSKKYLKIPDSKKLAELKNSKLGEESTSSMHEANASMVGSNSVDKE
ALGKIRTSKDASNSVEKSTSSSCSSCILLVSSPCAYICSCSSPTEKSSDKQTSEDGMFYC
SLCEVEVFKYSKHCRVCNKCVDHFDHHCRWLNNCIGKKNYRQFFTLMVAAMLLFILQWLT
GILVLICCFVKRKEFSVDISSKLGTSFSLVPFVLVVSICTILAMIATLPVVQLFFFHILL
INKGLSTYDYIIAMREQEQEQLGNGGQQSPQMSTVSSFTGLSSASSFTTLHRGAWCTPPR
LLLQDQFDVVPPETASVSSVGKKTMREDPLKKKNPGTVKISPWTLARLNAEEISKAAAEA
RTKSKVLQPVTRHGEAIRLEPESSFSSSGRRMVPRIESNKKGASKRIHHPANLSMESLTK
VSASNTDKGLSGMSRLAPLPFEAHNTFQTSQPMSSSAGIVPSSPESSLDSPDIHPFRVSS
SGAEKARQLAVAGASGAGAATLKEISLSGSTSDGYEASGGEDSDRVVPFRIVQRSTNWTN
LFRADQDERAFKKPQSSTIVGHR
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaacatggatggcagttaccttaccatcctcttcaggtggtagctgttgctgtg
tttctggctctggggtttgccttctatgtgttcttcgctccttttgttggaaagaagatg
tatcagtacattgtcactggcctttactcacagctgattattagtgtctttggactgtac
atatggtgtgcagcagcagatccagcagatccaggggtttttaagtccaaaaagtatctt
aaaatcccagacagtaaaaagcttgctgaactaaagaattctaaactaggtgaagaatca
acttcatcaatgcatgaagcaaatgcttcaatggttggatctaattctgtggataaagag
gcattgggaaaaatacgaacttcaaaagatgcttcgaattcagtagagaagagtacatca
tcgtcttgttcatcctgtatcctcttggtttcttctccttgtgcatatatctgcagctgc
tctagtccaactgagaaatcttctgataaacaaacaagtgaagatggcatgttctattgc
agtttgtgtgaagttgaggttttcaagtacagcaagcactgtagagtctgcaacaagtgt
gtagaccactttgatcatcattgccgatggcttaacaactgtataggcaaaaagaattat
cgacaatttttcaccctcatggttgcagctatgctcttgtttattcttcaatggttgact
gggatacttgtgcttatctgctgttttgtcaagaggaaggaattttctgtggatatctcc
tccaagttgggaaccagtttctctttggttccctttgttcttgtggtgtctatctgcacc
attctggctatgattgctaccttaccggttgttcagcttttcttctttcatattctcctc
attaacaagggactcagcacatacgattacatcatagcaatgagggagcaagagcaggag
cagctaggaaatggaggtcagcaaagtccccaaatgtcaactgttagctcatttactgga
ttgagtagtgcaagctcctttactactttacaccgaggtgcatggtgcacaccccctcgc
ctgttgcttcaagatcagtttgatgtggtgcccccagaaacagcatctgtaagttcagtg
gggaagaagacaatgagagaagatccattaaagaaaaagaatcctggaacagtcaaaatt
agtccttggacattggcacgcttaaatgcagaagaaatttctaaagctgctgcagaagca
agaacaaaatccaaagttctgcagcctgtaacaagacatggtgaggctatcaggctagaa
ccagaaagcagttttagtagcagtggccgaagaatggttcccagaattgagagcaataag
aaaggagctagtaagcggattcatcatcccgccaacttgtctatggagtccttgacaaaa
gtttctgccagtaatactgataaaggcttgagtgggatgtctaggttggcccctctccca
tttgaagcacacaacacatttcaaacaagtcaaccaatgtcaagctcagctgggattgtt
ccttcatctcctgaaagcagtttagactctcctgatattcacccttttagggtgtcttca
tcaggtgctgaaaaagcaagacagcttgcagttgcaggtgcttcaggtgctggtgctgca
actctgaaggaaatttcactgtcaggttcaactagtgatggatatgaggcttctggtggg
gaagatagtgaccgggttgttccttttaggattgttcagagatctacaaattggactaat
cttttcagagctgatcaggatgagagggcttttaaaaagcctcaatcttcaaccattgtt
ggtcatagatag

DBGET integrated database retrieval system