KEGG   Glycine max (soybean): 100815484Help
Entry
100815484         CDS       T01710                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00020  Citrate cycle (TCA cycle)
gmx00640  Propanoate metabolism
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
gmx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100815484
   00640 Propanoate metabolism
    100815484
Enzymes [BR:gmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     100815484
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     100815484
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 100815484
NCBI-ProteinID: XP_003548295
UniProt: I1MQH3
Position
16
AA seq 325 aa AA seqDB search
MARQALTKLLSSIASRRHHGLRHFSAASPAVFVDKSTRVICQGITGKNGTFHTEQAIEYG
TNMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVIYVPPPFAAAAIMEAMEAELDL
VVCITEGIPQHDMVRVKAALNRQSKTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIGIV
SRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLQKFLTDPQTEGIILIGEIG
GTAEEDAAALIKESGTEKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKTLREAG
VTVVESPAKIGAAMLDVFKQRGLVQ
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacaagctctgaccaaattgctgtcctcgatcgcctcgcgccgccaccatggc
ctccgccacttctcggcggcctcgccggcggtcttcgtcgacaagagcacgcgcgtgatc
tgccaaggcatcaccggcaaaaacggcaccttccacaccgaacaagccatcgaatacggc
accaacatggttggtggtgtgactcctaagaaaggtggaaccgaacacttgggccttccc
gtcttcaacaccgttgccgaggcgaaggcggagactaaggccaacgcttccgtcatctac
gttcctccgccgttcgccgcggccgccatcatggaggccatggaggctgaactggatctc
gtcgtctgcatcacagagggcattccccagcacgacatggttagggttaaagcagcactt
aacaggcagtccaagactcgtttgataggaccaaactgccctggcattatcaagccgggg
gaatgcaaaattggaatcatgccaggttatattcataagcctggtcgcataggaatcgtc
tctcgttctggtaccttgacatatgaagcggttttccaaacgactgctgttggccttgga
caatccacttgtgtgggtataggaggagatccctttaatggaacaaacttcgttgactgc
cttcagaagttcctaactgatcctcaaacagaaggtatcattcttataggagagatagga
ggaactgccgaagaggatgctgctgcactaattaaggagagtggaactgagaagcctgtt
gttgcttttattgctggtttaactgctccccctggtcgtcgtatgggtcatgctggagct
attgtgtcgggtggcaagggcactgcacaagacaaaattaaaaccctcagggaagctggg
gtcacagttgtggagtcccctgccaaaattggagctgccatgctagatgttttcaagcag
aggggcttggttcaatag

DBGET integrated database retrieval system