KEGG   Glycine max (soybean): 100815749Help
Entry
100815749         CDS       T01710                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00010  Glycolysis / Gluconeogenesis
gmx00562  Inositol phosphate metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100815749
   00562 Inositol phosphate metabolism
    100815749
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100815749
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100815749
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100815749
NCBI-ProteinID: XP_006579840
UniProt: I1K1W1
Position
5
AA seq 494 aa AA seqDB search
MSNSMPFVLLILLLSVLRYSSAEEAFHVRKHLSTVSRYGAAKDIADNNFVPSKIPKGCVP
IHLNLVARHGTRSPTKKRIKELDNLSERLEVLVRDAKERNLPLERVPSWLNEWKSPWQGR
RKGGELVIKGEEELYDIGIRIRERFPNLFDEEYHPDIYPIKATQVPRASASAVAFGMGLF
SGNGSLGLGHHRAFAVTSESRASDIVLRFHDCCHNYKAHRKSQEPAVSKLKEPILDEITS
ALIGRHGLNFTKQDTSSLWFLCKQEASLLDITNQACSLFRPPEIELLEWTDDLEMFILKG
YGKSLNYRMGLPLLEDVVQSMEQAIVVEEERHAPGSFEKARLRFAHAETVVPFSCLLGLF
LEGSELKKIQKEQPLQHPPKPPQKRKWRGSTVAPFAGNNMLVLYSCPAPDKSTSKHFVQV
LHNEHPVPLPGCDGSDFCPFEVFKEKIVAPHQKHDYHTVCNAKLEQEPSGSKVFQIFKWL
SSLGKGDKYPKDEF
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgagcaactccatgccttttgttctgctaatattattactttcggttttacgttactca
agcgccgaagaagctttccatgttcgcaaacatctctccactgtctctagatatggtgct
gcgaaagacattgctgacaataacttcgtaccttccaaaatccccaagggatgtgttccg
atccatttgaatctcgtggcgaggcatggaactcgatctcctacaaagaaaaggataaag
gagttagataatttgtcagagcgtctggaagttcttgtaagggatgcaaaagagagaaat
ttgcctttggagagagttccttcttggctaaatgaatggaaatctccctggcagggaagg
cgtaagggcggcgaattagttatcaaaggagaggaagagttatatgatattggaatcagg
attagggaaaggtttccaaatttgtttgatgaggaataccatccagacatatatcctatt
aaggcaactcaggttccccgggcatctgctagtgctgttgcatttggaatggggcttttc
agtggcaatggaagtcttggacttgggcatcaccgagcctttgctgttactagtgaaagt
cgtgctagcgacattgtgctgagatttcatgattgttgtcataattacaaggctcatcgg
aaaagccaggaacctgcagttagtaaacttaaggaacctatattggatgagattacatct
gcattgattgggcgccatgggctgaattttacgaagcaggatacatcttctctctggttt
ttgtgtaaacaggaagcatccttgttggatataactaatcaagcgtgtagtcttttccgc
cctcctgagattgaattgctggagtggacagatgatctggagatgtttattctgaagggt
tatggtaaatcactaaactatagaatgggactgccattacttgaagatgttgttcaatcc
atggaacaggctatcgtggttgaagaagaaagacatgctcctggcagttttgaaaaggca
agacttcggtttgcgcacgctgaaactgtagttccattctcatgtctgcttggtttattt
cttgaaggatctgagttaaaaaaaattcagaaggagcaacctttgcagcaccctccaaag
cctccacagaaaagaaaatggcggggtagcactgtggccccttttgctggtaacaacatg
ttagtcttgtatagttgtcctgctccagacaaatctaccagcaagcacttcgtgcaagtg
ttacacaatgaacaccctgttccattgccaggttgtgatggctctgatttctgtccattt
gaagtattcaaggaaaaaatagttgcacctcatcagaagcatgactaccatacagtctgt
aatgcaaagctagagcaggagccctcgggcagcaaggtttttcaaatatttaagtggctt
tcctcactagggaaaggtgataagtatcctaaagatgaattttag

DBGET integrated database retrieval system