KEGG   Glycine max (soybean): 100816187Help
Entry
100816187         CDS       T01710                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK5 isoform X1
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gmx01001]
    100816187
   01009 Protein phosphatases and associated proteins [BR:gmx01009]
    100816187
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100816187
Protein kinases [BR:gmx01001]
 Serine/threonine kinases: Other
  Wnk family
   100816187
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100816187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal OSR1_C
Motif
Other DBs
NCBI-GeneID: 100816187
NCBI-ProteinID: XP_003517007
UniProt: K7K3L1
Position
1
AA seq 609 aa AA seqDB search
MYKGRLGGKAQLGYVETDPLGRYGRFRDILGKGAVKVVYRAFDEVLGIEVAWNQVKLGDV
FHSPDLLPRLYSEVHLLKNLEHDSIMTFHDSWIDVNCRTFNFITELFTSGTLREYRKKYQ
RVDIRAVKNWARQILSGLEYLHSHDPPVIHRDLKCDNIFINGHLGQVKIGDLGLAAILRG
SQHAHSVIGTPEFMAPELYEEEYNELVDIYSFGMCMIEIFTSEFPYSECSNPAQIYKKVT
SGKLPEAYYRIHDLEAQRFVGKCLANVSERLSAKELLLDPFLAKEQLDSPLPSPTLPKKQ
APTLNFTASLAKELSQPKSNQTKDSHMTITGSINEEDDTVFLKVQISNKDGQKRNIFFPF
DTIYDTAIDVAMEMVKELEISDLEPLEIAKMIEEEISALVPKWRDWGSAEYQKQHSFSYE
EEYDMSNHHPFFSTSSRSSSHASLPVFGSSYKNNSHYRGNHYPFAQDWPQDELFMNDDAS
SQSSMNSFKCFNFNCCDPGNEDEHDPTLVLGAEHLYYTPKGNEKCIRFCPREEVMDADFT
KQLCNMRMDSHRCHGMHRLTRIRSFVDLRRQQLQRSLMEEIHKRRMFKTVGAVENIGFQN
PEGGGCFSY
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagggaagattaggaggcaaggctcagcttggatatgttgaaactgaccctttg
ggtcgatatggacgtttcagggacattctaggcaaaggagcagtgaaggtagtgtatagg
gcctttgatgaggtcctaggaatagaggtggcttggaaccaagtcaagcttggtgatgtg
tttcattcaccagatctacttccgaggctttattcagaggttcatctcctcaagaacttg
gaacatgactccatcatgaccttccatgattcttggattgatgtcaactgtagaaccttc
aacttcatcaccgaattgttcacatctggcaccctacgagagtatagaaagaagtaccag
cgagtagatatcagagcagtgaagaattgggcacgccagattctaagtggcttggagtat
ttgcacagccatgatcctcctgtgatacatagagacctcaaatgtgacaatatcttcatc
aatggccatctggggcaggtcaagattggtgacttgggccttgcagccattctccgtggc
tcccaacatgcacacagtgtcataggtacaccagaatttatggcacctgaattgtatgaa
gaggaatacaatgagctggtcgacatatactcctttgggatgtgcatgatagaaattttt
acttctgagttcccgtacagcgagtgctctaaccctgctcagatatacaagaaagttact
tcggggaagctaccagaagcctattacagaatccatgacttggaagcccaaagatttgtg
ggaaaatgtttggcaaatgtctcagagaggttgtcagcaaaggagctcttgttggaccca
tttttagccaaggaacaactagactctccacttcctagcccaacattacctaaaaaacaa
gcccccacactcaatttcactgcatcacttgccaaagagttatctcagccaaagagtaac
caaacaaaggactcacacatgacaatcaccggatcaataaatgaagaggatgacacggtt
ttcctgaaagtacaaatttctaacaaagatgggcaaaagagaaacattttctttccattt
gacaccatatacgacactgccattgatgtggcaatggagatggttaaagaactggagatt
agtgacttggaaccattggagattgctaaaatgattgaggaggagatatcagctttggtc
cctaaatggagggattggggcagtgctgagtatcaaaagcagcatagttttagctatgaa
gaagagtatgacatgagtaaccaccaccctttcttctcaacatcttctcgctcttcctct
catgcttctcttccagtgtttggttcttcctacaagaataattcccactatcgtgggaat
cattacccttttgctcaagattggcctcaagatgaactatttatgaatgatgatgcgagc
tctcaaagctcaatgaactccttcaagtgtttcaatttcaattgctgtgaccctggcaat
gaagatgagcatgatccaactctagtactaggagcagaacacctttactacaccccaaaa
ggaaacgaaaagtgcataagattttgtcctagagaagaagtgatggatgctgatttcacc
aaacagttatgcaacatgagaatggattctcacaggtgtcatggaatgcacaggctaacc
aggatccgttccttcgtggacctgaggagacaacaactgcaacgatcactgatggaggag
attcacaagaggagaatgttcaagacggttggtgccgttgagaacattgggtttcagaat
ccagaaggaggcggatgtttttcttattga

DBGET integrated database retrieval system