KEGG   Glycine max (soybean): 100816625Help
Entry
100816625         CDS       T01710                                 

Definition
(RefSeq) serine/threonine-protein kinase GRIK2 isoform X1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gmx01001]
    100816625
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100816625
Protein kinases [BR:gmx01001]
 Serine/threonine kinases: Other
  CAMKK family
   100816625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 100816625
NCBI-ProteinID: XP_006591145
UniProt: A0A0R0HNB9
Position
11
AA seq 430 aa AA seqDB search
MLNKTLSFAMGCCSCFGFIRTPNRQSQRSKPATNNNNLCQEPLLDDDIEDEEGEHLYNDE
VTNTSGDEGEEETRPKRSEEILNLRVENDMICTRFPVKETHKLVRTEDENGNKMINEYIR
ECKIGSGSYGKVALYQSSVDGKNYAIKAFHKSHLLKLRVSPSETAMTDVLREVFQLILLP
GLVLIMKMLEHPNIVDLIEVIDDPQSDNFYMVLEYVEGKWICEGSGTTCGLGEETARRYL
RDIVSGLTYLHAHNIVHLDIKPDNLLITRHGTVKIGDFSVSQAFEDDKDELRRSPGTPVF
TAPECILGVKYGGKAADTWAVGVTLYCMILGEYPFLGDTLQDTYDKVRNTHSDIYDKIVN
NPLVLPNDMNPPLKNLIEGLLSKDPRLRMSLSDVAEDSWVIGDDGPIPDYLCWCKMKSLG
IEDNDESNTD
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgctcaataagactctctcttttgccatggggtgctgtagttgcttcgggttcatcagg
acacctaaccgtcaaagtcaaaggtctaagcctgccactaacaataataatctctgccag
gagcctcttctagatgatgacattgaagatgaagagggtgagcatttgtacaatgatgag
gttactaacactagtggagatgaaggcgaggaggaaactcgtcccaagcgatcggaagaa
attttgaacttgagagtagaaaatgacatgatttgtacacggtttcctgttaaggagact
cacaaacttgtgcgcaccgaggatgaaaatgggaacaagatgataaatgagtatattcgt
gagtgtaaaattggttctggtagctatgggaaagtggctctttatcaaagctctgtcgat
ggaaagaattatgcaattaaggcctttcataaatctcatttactgaagcttcgagtttca
ccctcagaaactgccatgactgacgtactacgcgaggtttttcagcttattttgcttcct
ggtttggttctcattatgaaaatgctggaacatcctaatatagtcgatctcattgaggtg
attgatgacccacagtcagataacttctacatggtacttgaatatgtggaaggaaaatgg
atatgcgagggttcaggtaccacttgtggcttaggtgaagagactgctaggagatacttg
cgtgatatagtttctggattaacatatctccatgctcataatattgttcatctggatatt
aagccagataatctgttgattactcgtcatggtacagtaaagataggggatttcagtgtc
agccaggcttttgaggatgataaagatgagcttcgtcgatcacctggcactcctgttttc
actgcaccagagtgtattttaggtgtgaaatatggtggtaaagctgcagacacgtgggca
gtaggagttactttatactgtatgatattgggtgaatacccttttcttggagacacactt
caagatacatatgacaaagtaagaaatacacactcagacatatatgacaaaatagtcaat
aatcctttagtactccccaacgatatgaatcccccattgaagaacttaatagaaggccta
ctttccaaagacccaagattaaggatgtctttaagtgatgttgcggaagatagctgggtt
attggagatgatgggccaattcctgattacctttgttggtgcaaaatgaagagcttggga
attgaggacaatgatgagagcaatactgactaa

DBGET integrated database retrieval system