KEGG   Glycine max (soybean): 100817908Help
Entry
100817908         CDS       T01710                                 

Definition
(RefSeq) probable receptor-like serine/threonine-protein kinase At5g57670
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gmx01001]
    100817908
Enzymes [BR:gmx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100817908
Protein kinases [BR:gmx01001]
 Serine/threonine kinases: TKL group
  IRAK family
   100817908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Usp APH ABC1
Motif
Other DBs
NCBI-GeneID: 100817908
NCBI-ProteinID: XP_003526871
UniProt: I1KBL7
Position
6
AA seq 700 aa AA seqDB search
MMLIGDGAGCRKVLVGVKLDPRSRELLTWALVKVAEPGDLVIALHVLDSITEGTASLLSL
VKTFDSVLGVYEGFCNLKQVGLRLKVCRGGSVRKALVQEAKAFGVSTVILGTSKSYHTIR
SSAWVAKYCAKKLPKCISVFSVDNGKIAFRREANGNCSDREKLCEGSSLSSKSLVVYTNK
NMKSCGSCALQEGSGTEFEQGLCEDVEKENPLALVPFKKLEDAPCFSVVVDNSKPKPGWS
LLRHVFHHKKHNHKSSSMKNTFVFQRALRQPNCHSSAVVHPDHKQISFKQIDDSPLDGVS
GAIVPFESATTTLFTLPSICSGLSSLPEELLVLQEKYSSLCRLYRLQELLSATSNFASDN
LIGRGGCSYVYRGCLPDGEELAVKILKPSENVIKEFVQEIEIITTLRHKNIISISGFCLE
GNHLLLVYDFLSRGSLEENLHGNKVDCSAFGWQERYKVAVGVAEALDYLHNGCAQAVIHR
DVKSSNILLSDDFEPQLSDFGLASWGSSSSHITCTDVAGTFGYLAPEYFMHGRVTDKIDV
YAFGVVLLELLSNRKPINNECPKGQGSLVMWAIPILEGGKFSQLLDPSLGSEYDDCQIRR
MILAATLCIRRVPRLRPQISLILKLLHGDEEVIRWAEQEVIAPQELDGCDEEPVPTNIQS
HLNLALLDLEDDTISISSTEQSVSLEDYLHGRWSRSSSFD
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgatgttaatcggcgacggtgccggttgccggaaagtcctcgtcggcgttaaattagat
cctcgcagccgcgaattgctgacgtgggctctcgtcaaggtcgccgagcccggcgacctc
gtcattgcgcttcacgtcctcgactccatcactgagggaacggcatcgctgttatctctc
gtgaagacgttcgattccgttctcggcgtttatgaaggcttctgcaacctaaaacaggtt
ggtctgaggcttaaagtgtgtcgcggaggttcggtaaggaaggcgttggtgcaggaggca
aaggcgtttggcgtttccaccgtgattttgggaacttcgaaatcttatcatactattcgt
tcttccgcgtgggttgcgaaatactgcgcaaagaaattgccgaagtgtatctctgttttc
tccgttgataatggcaaaatcgcgttccggagagaagctaatggaaattgcagtgatcga
gagaaattgtgtgaagggtcaagtttgtcgtcaaaatcgttggtggtttacacaaataag
aatatgaagagttgtggaagttgtgcattgcaagagggttctggaactgagtttgagcaa
gggttgtgtgaggatgttgagaaggagaatccgcttgctttggttccgtttaagaagctt
gaagatgctccttgtttttcggttgtggtggataattcgaagcctaaacctggttggtca
ctgcttcgccatgtgtttcatcacaagaagcataaccataagtcttcttctatgaagaat
acatttgtttttcaacgggcgttgcggcagccgaattgtcattcttctgctgtggtccat
ccagatcataaacaaattagttttaagcagattgatgattcccctcttgatggggtgagt
ggtgccattgtgccatttgaatctgctacaactactctctttactcttccctccatttgc
agtggtttgagtagccttcctgaagaattgttagtattacaagagaagtactcgtccttg
tgccgattatatcgtttgcaggaacttttatctgcaacctccaactttgcatctgataat
ttgattggcagaggtggctgtagttatgtttacagaggatgtcttccagatggcgaggaa
ttggcggtgaaaattttgaagccgtctgaaaacgtgataaaggagtttgttcaggaaatt
gagatcattacaactttgcgccacaagaacataatatctatatctggcttttgtttagag
ggcaaccatttgctactagtgtatgattttttatcaagaggaagcctggaagaaaacctt
catggcaacaaggtggactgtagtgcatttggttggcaagaaaggtacaaggtggccgtg
ggtgtagctgaggcactggattatctgcataatggctgtgctcaggctgtgatccatagg
gatgtgaaatcttctaatatccttctttcagatgattttgagcctcagctttcagatttt
ggactggctagttggggttcatcttcttcccatattacttgtactgatgtggccggaact
tttggatacctcgcacctgagtactttatgcacggtagagtgactgataaaattgacgta
tatgcttttggtgttgtactccttgagcttctctcaaataggaagcccattaacaatgaa
tgcccaaagggccaggggagccttgttatgtgggcaataccaattttggaaggtgggaag
ttttcccagttgcttgatccaagcctaggcagtgaatatgacgattgccagatcaggaga
atgattttggccgctactctctgcattagacgggttcctaggttgcgacctcaaatcagc
cttatattgaaacttctgcacggtgatgaagaggtgataagatgggcagaacaagaagtt
attgcgccacaggaactcgatggatgtgatgaggaaccagttccaactaacattcagtca
cacctaaaccttgctttactggacttggaggatgatacgatttctatcagtagcaccgag
cagagtgtctctttggaggactatttgcatggaagatggagtcgatcttcaagttttgac
taa

DBGET integrated database retrieval system