KEGG   Glycine max (soybean): 100818412Help
Entry
100818412         CDS       T01710                                 

Definition
(RefSeq) methionine--tRNA ligase, chloroplastic/mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00450  Selenocompound metabolism
gmx00970  Aminoacyl-tRNA biosynthesis
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    100818412
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    100818412
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gmx01007]
    100818412
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gmx03016]
    100818412
Enzymes [BR:gmx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     100818412
Amino acid related enzymes [BR:gmx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   100818412
Transfer RNA biogenesis [BR:gmx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    100818412
 Prokaryotic type
   Other AARSs
    100818412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 100818412
NCBI-ProteinID: XP_003555819
UniProt: A0A368UGD8
Position
20
AA seq 605 aa AA seqDB search
MAVRINSSIQNTLCLLNPPLFSLRYRASSLKLKPQLHFRQNPSRGALFCTCATTDITPQS
TEHFVLTTPLYYVNAPPHMGSAYTTIAADAIARFQRLLGKSVIFITGTDEHGEKIATAAM
AQGSTPPDHCNLISRSYKTLWKDLDISYDKFIRTTDSKHEAIVKEFYSRVLANGDIYRAD
YDGLYCVNCEEYKDEKELLDNNCCPVHLKPCVSRKEDNYFFALSKYQKALEDTLYRNPNF
VQPSFRLNEVQSWIKSGLRDFSISRASVEWGIPVPDDKTQTIYVWFDALLGYISALSDDQ
EQPDLLKTVSSGWPASLHLIGKDILRFHAVYWPAMLMSAGLSLPKMVFGHGFLTKDGMKM
GKSLGNILEPNDLVNKFGTDAVRYFFLREVEFGNDGDYSEERFINIVNAHLANTIGNLLN
RTLGLLKKNCQSILVVDSTTAAEGNEFKDNVEKLVDKAHIHYENLSLSSACEAVLEIGNV
GNLYMDQRAPWSLFKQGGTAAEAAAKDLVIILETVRIIAIALFPVTPSLSWRIYAQLGYS
RDQFDAATWRDTKWGGLKGGQVMAQPKPVFARIENQTEVEDKGVAVRKTKKSKAKPKQPQ
EVAGA
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgagaataaacagctccattcaaaacaccctctgtctcctcaaccctcctctg
ttttccctccgttacagagcttcttccctgaagttgaaaccccaattgcattttcgtcaa
aacccctctcgaggagctttattctgcacatgcgccaccaccgatatcactccccaaagt
accgaacactttgtcctcactacccctctctactacgtcaatgctcctccccacatgggt
agcgcttacaccaccatcgctgccgatgccattgctcgcttccagcggctattggggaag
agtgttatatttattactggcacggatgaacatggggagaaaattgcaactgctgccatg
gctcagggttccacccctcctgaccattgcaatctcatatctcgatcttacaagacgctt
tggaaagatttagatatttcttacgacaagttcattagaacaactgatagcaagcatgaa
gcaattgtgaaggaattttattcaagagtgcttgccaatggtgacatctaccgagctgat
tatgatggactttattgtgtaaactgtgaggaatataaggatgagaaggaacttcttgat
aataattgttgtccagttcacctaaagccttgtgtttcaaggaaagaggacaattacttt
tttgcactgtcaaaatatcagaaggcattggaggatactctttatagaaatccgaatttt
gtgcagccatctttccgtttaaatgaggttcaaagttggatcaaaagtggcttgagggac
ttttccatttcccgagcatcagttgagtggggcattcctgttcctgatgacaagacccag
actatatatgtatggtttgatgctttactaggctatatatcagcactatctgatgatcag
gaacaacctgatttacttaaaactgtttcttcaggttggccagcttcactgcacttgatt
ggtaaggatattctacgcttccatgctgtttactggccagctatgctaatgtctgctgga
ctaagccttcctaaaatggtatttggccatggattcttgacaaaggatggaatgaagatg
ggcaagtcactagggaatatacttgaaccaaacgatttggttaataaatttgggacagat
gcagttagatacttcttcctcagagaggtggaatttggcaatgatggagactattcagag
gaacgcttcatcaatattgtgaatgcacatcttgccaatacaattggaaatcttcttaat
cggacactaggacttctgaaaaagaactgccaatcaattctggtggtggattccactaca
gctgctgaaggaaatgaattcaaggacaatgtagagaagctggttgataaagctcacatt
cactatgaaaatctctctctgtcatcagcttgtgaggctgttctggagattggtaatgtt
gggaatttgtatatggatcagcgtgcaccatggtctctctttaagcaagggggcactgct
gctgaagcagctgctaaggaccttgtaattatattagagacagtgaggattattgcaatt
gcactctttcctgttacaccaagcttgagttggagaatatatgcacaacttggctattcc
agggaccaatttgatgcagcaacctggagagacaccaagtggggtgggcttaagggtggc
caagtcatggctcaacctaaaccagtctttgctaggattgaaaaccaaactgaagtggaa
gacaaaggggttgcagtcagaaagactaagaaaagcaaagcgaagccgaaacaacctcaa
gaagttgccggagcctag

DBGET integrated database retrieval system