KEGG   Glycine max (soybean): 100819843Help
Entry
100819843         CDS       T01710                                 

Definition
(RefSeq) uncharacterized protein LOC100819843
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00520  Amino sugar and nucleotide sugar metabolism
gmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100819843
Enzymes [BR:gmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     100819843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase Polysacc_synt_2 NAD_binding_4 3Beta_HSD RmlD_sub_bind KR adh_short
Motif
Other DBs
NCBI-GeneID: 100819843
NCBI-ProteinID: NP_001240928
UniProt: C6TKZ2
Position
12
AA seq 342 aa AA seqDB search
MATNSSNGATKQPPMPSPLRFSKFFQSNMRILVTGGAGFIGSHLVDKLMENEKNEVIVAD
NFFTGSKDNLKKWIGHPRFELIRHDVTEQLLIEVDQIYHLACPASPIFYKYNPVKTIKTN
VIGTLNMLGLAKRVGARILLTSTSEVYGDPLEHPQPESYWGNVNPIGVRSCYDEGKRVAE
TLMFDYHRQHGIEIRIARIFNTYGPRMNIDDGRVVSNFIAQAIRGEPLTVQVPGTQTRSF
CYVSDMVDGLIRLMEGENTGPINIGNPGEFTMIELAENVKELINPKVEINMVENTPDDPR
QRKPDITKAKELLGWEPKVKLRDGLPLMEEDFRQRLGVPKSN
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgaattcttctaatggagcaacaaagcaacctcccatgccatctcccttgcgg
ttttccaagttctttcagtccaatatgagaattctggttactggaggagctggatttatt
ggctctcacctagttgacaaattgatggaaaatgaaaaaaatgaggtcattgttgctgac
aacttcttcactggatctaaagacaaccttaaaaaatggattggccatccaagattcgag
ctaattcgtcatgatgtcacagagcaattgttgattgaggttgatcaaatctaccatctt
gcatgcccagcttctccaattttctacaaatacaaccctgtaaagacaataaagacaaat
gtgattggaacactgaacatgcttggtcttgctaagcgtgtgggagcaaggattttgctt
acatctacttcagaagtatatggggaccctcttgagcatccacaaccagaaagctattgg
ggcaatgttaatcctattggagttcggagttgttatgatgagggcaagcgtgttgcagaa
actttgatgtttgattatcataggcagcacggaatcgaaatacgcattgcgagaatcttt
aacacatatggaccacgcatgaatattgatgatgggcgtgttgtcagtaacttcatcgct
caagcaattcgtggtgaacccttaactgtccaagttccaggaactcaaactcgcagtttt
tgctatgtctctgacatggttgatggacttatacgtctaatggaaggggaaaacactggt
ccaatcaacattgggaacccaggcgaatttactatgattgaacttgctgagaatgtgaaa
gagcttattaatccaaaagtggagataaatatggttgagaacactcctgacgatcctcgt
cagagaaaaccagacattacaaaagcaaaggaattgctgggatgggaaccaaaggtcaag
ttgcgtgatggccttcctcttatggaagaggatttccgtcagaggcttggggttcccaag
agcaactaa

DBGET integrated database retrieval system