KEGG   Glycine max (soybean): 102661011Help
Entry
102661011         CDS       T01710                                 

Definition
(RefSeq) protein HASTY 1
  KO
K14289  exportin-5
Organism
gmx  Glycine max (soybean)
Pathway
gmx03013  RNA transport
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    102661011
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gmx03016]
    102661011
   03036 Chromosome and associated proteins [BR:gmx03036]
    102661011
Transfer RNA biogenesis [BR:gmx03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    102661011
Chromosome and associated proteins [BR:gmx03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     102661011
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 102661011
NCBI-ProteinID: XP_006575249
UniProt: A0A0R0L419
Position
2
AA seq 207 aa AA seqDB search
MGCLQREGRLLQGEHNLLGEAFLVMSSSAGIQQQQDVLRWLLEPLSVQWTQLEWQDKYLS
GPHGLVQLCSDVPVMWSIFHTVTFFERALKRSGLKKANWNSENSSTPNSIPLNPMASRIS
WMVTPLLKLLRCIHSLWSPSVSQALPGEVRAAMVMGDVERFSLLGEGNSKLPKGVTDGSK
IDMNKEGYTEPNESDIRNWFKGIRDSG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtttgcaaagggagggtcgtttgcttcagggagagcataatcttttaggcgaa
gcatttcttgttatgtcttcttctgctgggatccaacaacaacaagatgttttaaggtgg
ttactagaacctttaagcgttcagtggacacaattggagtggcaggataagtatttgtca
ggtccacacggtttggttcagttgtgctcagatgtgcctgttatgtggtcaatttttcat
acagtgacattctttgagagggcacttaagaggagtggattgaagaaagccaattggaat
tcagaaaacagctcaacaccaaattcaatccctttaaatccaatggcctctcgcatatca
tggatggtgactcctctcttgaaactacttcgctgtatacattccctttggtctccatct
gtaagtcaagctttacctggtgaggtcagagctgcaatggtcatgggtgatgttgagagg
ttcagtcttcttggagaagggaactctaaattaccaaaaggtgtcacagatggatctaag
attgacatgaataaagaaggatacactgaacccaatgaatcagatattcgaaattggttt
aaaggcatcagagacagtgggtga

DBGET integrated database retrieval system