KEGG   Glycine max (soybean): 102667417Help
Entry
102667417         CDS       T01710                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin TLP1_add_C
Motif
Other DBs
NCBI-GeneID: 102667417
NCBI-ProteinID: XP_025983380
Position
2
AA seq 84 aa AA seqDB search
MLLPFLRSSQHYTLEKAYEICIKRDLLREQVFILGRMGNSKQALAVIINKLGDVEEAVEF
VTMQHDDELWEELIKQCLHKPKMV
NT seq 255 nt NT seq  +upstreamnt  +downstreamnt
atgttgctaccttttctccgtagcagtcaacactacacccttgagaaggcttacgaaatt
tgcattaaaagagacctattgagggagcaagtcttcatcctaggaaggatgggaaactcg
aagcaagccctagctgttattataaacaaattgggggatgtagaggaggccgtagagttt
gtcactatgcagcatgatgatgaactttgggaagaattaatcaagcaatgtcttcacaaa
cctaaaatggtataa

DBGET integrated database retrieval system