KEGG   Glycine max (soybean): 102667578Help
Entry
102667578         CDS       T01710                                 

Definition
(RefSeq) probable mediator of RNA polymerase II transcription subunit 37c
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
gmx  Glycine max (soybean)
Pathway
gmx03040  Spliceosome
gmx04141  Protein processing in endoplasmic reticulum
gmx04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    102667578
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102667578
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102667578
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gmx01009]
    102667578
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:gmx03041]
    102667578
   03009 Ribosome biogenesis [BR:gmx03009]
    102667578
   03110 Chaperones and folding catalysts [BR:gmx03110]
    102667578
   04131 Membrane trafficking [BR:gmx04131]
    102667578
   03051 Proteasome [BR:gmx03051]
    102667578
   03029 Mitochondrial biogenesis [BR:gmx03029]
    102667578
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gmx04147]
    102667578
Protein phosphatases and associated proteins [BR:gmx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     102667578
Spliceosome [BR:gmx03041]
 Complex B
  Other components
   Prp19 complex
    102667578
 Complex C
   Prp19-CDC5 complex
    102667578
Ribosome biogenesis [BR:gmx03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    102667578
Chaperones and folding catalysts [BR:gmx03110]
 Heat shock proteins
  HSP70 / DNAK
   102667578
Membrane trafficking [BR:gmx04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    102667578
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    102667578
Proteasome [BR:gmx03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102667578
Mitochondrial biogenesis [BR:gmx03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    102667578
Exosome [BR:gmx04147]
 Exosomal proteins
  Proteins found in most exosomes
   102667578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FragX_IP DDR
Motif
Other DBs
NCBI-GeneID: 102667578
NCBI-ProteinID: XP_006574819
Position
2
AA seq 620 aa AA seqDB search
MAKKYEGCAVGIDLGTTYSCVAVWLEQHCRVEIIHNDQGNNTTPSCVAFTDQQRLIGEAA
KNQAATNPENTVFDAKRLIGRKFSDPVIQKDKMLWPFKVVAGINDKPMISLNYKGQEKHL
LAEEVSSMVLIKMREIAEAYLETPVENAVVTVPAYFNDSQRKATIDAGAIAGLNVMRIIN
EPTAAAIAYGLDKRTDCVEERNIFIFDLGGGTFDVSLLTIKDKVFQVKATAGNTHLGGED
FDNRMVNYFVQEFKRKNKVDISGNPRALRRLRSACERAKRILSYAVTTNIEVDALFQGVD
FCSSITRAKFEEINMELFEECMETVDRCLSDANMDKSSVHDVVLVGGSSRIPKVQELLQG
FFDGKVLCKSINPDEAVAYGAAVQAALLSKGIVNVPNLVLLDITPLSLGVSVQGDLMSVV
IPRNTTIPVRRTKTYVTTEDNQSAVMIEVYEGERTRASDNNLLGFFTLSGIPPAPRGHPL
YETFDIDENGILSVSAEEESTGNKNEITITNEKERLSTKEIKRMIQEAEYYKAEDKKFLR
KAKAMNDLDYYVYKIKNALKKKDISSKLCSKEKENVSSAIARATDLLEDNNQQDDIVVFE
DNLKELESIIERMKAMGKIG
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaaaatatgagggatgcgcagtgggaatcgaccttggtacaacttactcgtgt
gttgcagtgtggctggagcagcactgtcgagtggagatcatccacaacgaccaaggcaac
aataccaccccttcttgtgttgctttcacagaccaacagaggttgatcggtgaagctgct
aaaaatcaggctgccaccaacccagagaacactgtgtttgatgctaagaggttgattggt
aggaaatttagtgaccccgttattcaaaaagataaaatgttgtggccattcaaggttgtt
gctggtattaatgacaaacccatgatttcccttaactacaagggccaagagaaacacctt
ttagctgaggaagtgtcatctatggtcctcataaagatgcgggagattgcagaggcatat
ttggaaacacccgtagagaatgcagtggttactgtgcctgcttatttcaatgactctcaa
cgtaaagccaccatagatgctggtgctattgcaggcctcaatgttatgcggataatcaat
gaacccactgctgcagctattgcatatggccttgacaagagaactgattgtgttgaagag
cgaaacattttcatctttgaccttggtggtggtacttttgatgtatctctcctcacaatt
aaggataaggtctttcaagttaaggctactgcaggaaacactcaccttggaggggaggac
tttgacaaccgaatggtgaactactttgtacaggaattcaagaggaagaacaaagttgac
attagtgggaacccaagagccctaaggaggttgagaagtgcatgcgagagggcaaaaagg
atactctcatatgcagtgactaccaacattgaggtagatgctttatttcagggtgttgat
ttttgctcctcaatcactcgtgcaaagtttgaggaaatcaatatggagctctttgaagag
tgtatggaaacagttgataggtgtctttctgatgctaacatggacaagagcagtgtacat
gatgttgtccttgttggtggttcttctaggattcccaaagtgcaggagctattgcagggc
ttcttcgatgggaaggttctgtgcaagagcatcaaccctgacgaggctgttgcttatggt
gcagctgtgcaggctgctttgttgagtaaaggcattgtgaatgttccaaacttggtccta
ttggatattacaccactgtctcttggtgtatcggtacaaggagatctcatgagtgtggtg
attcctagaaatactaccattcctgtaaggaggacaaaaacatatgttacaactgaagac
aaccaatctgctgtcatgattgaggtttatgagggcgagagaacaagagcgagtgataac
aatttgctgggtttcttcacactttctggcattcctcctgctcctcgtggccatcctttg
tatgaaacctttgacatagatgaaaatggtattctatctgtttccgctgaggaagaaagc
accggcaataagaacgagattaccataaccaatgagaaagaaagactgtcaaccaaagaa
attaaaagaatgattcaagaagctgaatattacaaggctgaagataagaaattccttagg
aaggccaaagcaatgaatgatttggattattatgtttacaaaatcaagaatgctttaaag
aaaaaggatatcagctcaaagctttgctcaaaagaaaaggagaatgtcagttctgcaatt
gcaagagccacagatttgcttgaggataataaccagcaggatgatatagttgtgtttgag
gataatctgaaagagcttgagagcatcattgaacgcatgaaggccatgggaaaaattggt
tag

DBGET integrated database retrieval system