KEGG   Glycine max (soybean): 102669445Help
Entry
102669445         CDS       T01710                                 

Definition
(RefSeq) probable carotenoid cleavage dioxygenase 4, chloroplastic
  KO
K09840  9-cis-epoxycarotenoid dioxygenase [EC:1.13.11.51]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00906  Carotenoid biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Module
gmx_M00372  Abscisic acid biosynthesis, beta-carotene => abscisic acid
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00906 Carotenoid biosynthesis
    102669445
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.51  9-cis-epoxycarotenoid dioxygenase
     102669445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-GeneID: 102669445
NCBI-ProteinID: XP_006603550
Position
18
AA seq 117 aa AA seqDB search
MENDTGFPLIPNVFSGFNSLVASAACGSLSVARVLTGQFNPANGIGLANTSLVFFGNRLF
ALAESDLPYAVNVTPDGDIDRLGRHDFDEKLTFSMTAHPKIDLDTVECFAFCYGPVP
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgacactggtttccctctcatccccaacgtgttctccggcttcaactccctc
gtggcctccgcggcatgtggctccctctccgtggcacgtgtcttaacggggcagtttaac
cccgctaacggcattggcttggccaacactagcttagtcttcttcgggaatcgtctcttc
gcgcttgccgaatctgacctcccttacgccgttaacgtaacccctgacggcgacatcgac
aggctcggccgtcacgactttgacgaaaaactcacgttcagcatgacggcgcaccctaag
atagacctcgacacagtggagtgcttcgccttctgttacggccccgtgccatga

DBGET integrated database retrieval system