KEGG   Glycine max (soybean): 3989321Help
Entry
3989321           CDS       T01710                                 

Gene name
rpl20, GlmaCp043
Definition
(RefSeq) ribosomal protein L20
  KO
K02887  large subunit ribosomal protein L20
Organism
gmx  Glycine max (soybean)
Pathway
gmx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    3989321 (rpl20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:gmx03011]
    3989321 (rpl20)
Ribosome [BR:gmx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    3989321 (rpl20)
  Bacteria
    3989321 (rpl20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L20
Motif
Other DBs
NCBI-GeneID: 3989321
NCBI-ProteinID: YP_538787
UniProt: P19948
Position
CP
AA seq 130 aa AA seqDB search
MTRIKRGYIARKRRTKIRLFTSSFRGAHSRLTRTITQQKIKALVSAHRDRDRKKRDFRGL
WISRINAVIRGNIKVYYIYSNLVYSLYTGQLLLNRKIVAQIAILKQNCLFMIANDIIKTK
NPLRLYSGKV
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaccagaattaaacgaggatatatagctcggaaacgaaggacaaaaattcgtttattt
acatcaagttttcgaggagctcattcaagacttactcgaacgattactcaacagaaaata
aaagctttggtttcggctcatcgggatagagataggaaaaaaagagattttcgtggttta
tggattagtcgaataaatgcagtaattcgcgggaatattaaagtatattatatttatagt
aatttagtatatagtctatacacggggcaattgcttcttaatcgtaaaatagttgcacaa
atagctatattaaaacagaattgtctttttatgattgccaatgatatcataaaaaccaaa
aatccccttagactttactccgggaaggtatag

DBGET integrated database retrieval system