KEGG   Glycine max (soybean): 547540Help
Entry
547540            CDS       T01710                                 

Gene name
MAN1
Definition
(RefSeq) mannosyl-oligosaccharide 1,2-alpha-mannosidase
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00510  N-Glycan biosynthesis
gmx00513  Various types of N-glycan biosynthesis
gmx01100  Metabolic pathways
gmx04141  Protein processing in endoplasmic reticulum
Module
gmx_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    547540 (MAN1)
   00513 Various types of N-glycan biosynthesis
    547540 (MAN1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    547540 (MAN1)
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     547540 (MAN1)
Membrane trafficking [BR:gmx04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    547540 (MAN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_47 Apo-CIII Cnn_1N
Motif
Other DBs
NCBI-GeneID: 547540
NCBI-ProteinID: NP_001238057
UniProt: Q9SEH8
Position
8
AA seq 578 aa AA seqDB search
MARGSRSVGSSSSKWRYCNPSYYLKRPKRLALLFIVFVCVSFVFWDRQTLVREHQVEISE
LQKEVTDLKNLVDDLNNKQGGTSGKTDLGRKATKSSKDVLDDPIDIERREKVKEAMLHAW
GSYEKYAWGQDELQPQSKNGVNSFGGLGATLIDSLDTLYIMGLNEQFQKAREWVANSLDF
NKDYEASVFETTIRVVGGLLSAYDLSGDKVFLDKAIEIADRLLPAWNTPTGIPYNIINLS
HGRAHNPSWTGGESILADSGTEQLEFIVLSQRTGDLKYQQKVENVIAQLNKTFPDDGLLP
IYINPHSGAAGYSPITFGAMGDSFYEYLLKVWIQGNKTSSIKHYRDMWEKSMKGLSSLIR
RSTPSSFTYICEKNGGSLTDKMDELACFAPGMIALGSFGYSAADDSQKFLSLAEELAWTC
YNFYQSTPTKLAGENYFFHSGQDMSVGTSWNILRPETVESLFYLWRLTGNKTYQEWGWNI
FQAFEKNSRIESGYVGLKDVNSGVKDNMMQSFFLAETLKYFYLLFSPSSVISLDEWVFNT
EAHPLRIVTRHEEGLVKNLNEKQKPFSRIGGRKEGRSG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggcgagagggagcagatcagtgggtagcagcagcagcaaatggaggtactgcaaccct
tcctattacttgaagcgcccaaagcgtcttgctctgctcttcatcgttttcgtttgtgtc
tctttcgttttctgggaccgtcaaactctcgtcagagagcaccaggttgaaatttctgag
ctgcagaaagaagtgactgatttgaaaaatttggtggatgatttaaataacaaacaaggt
ggtacctctgggaagactgacttggggagaaaagctaccaagtccagtaaagacgtccta
gatgatcccattgatatcgagaggagggaaaaagtaaaagaagcaatgcttcatgcttgg
ggatcttatgagaagtatgcatggggacaagatgaacttcagccacaatcaaagaatggt
gtcaatagctttggaggtcttggagcaactttaatagattctcttgatacactatatatt
atgggtctcaacgaacagtttcagaaagcacgagaatgggttgcaaactctttggatttt
aacaaggattatgaagcaagtgtttttgagacaaccataagagtagtaggtggccttctt
agtgcatatgatctttcaggggacaaagtattcctcgacaaagcaatagaaattgcagac
agattactgcctgcatggaatacacctacaggaattccttacaacatcattaatttatca
catggacgagcacacaaccctagttggactgggggtgagagtatcttggcagattctggc
actgaacaactggaattcattgttctatcccaaaggactggagacctcaagtatcagcag
aaggtggaaaatgtaatagcccagctaaataaaacatttcctgatgatggattacttccc
atctacattaatcctcatagtggggcagcaggctactctcccatcacattcggtgccatg
ggtgatagtttttacgagtacttgctcaaagtttggatacaagggaataagacttcatcc
ataaaacattatagagatatgtgggagaaatcaatgaaaggcctgtcaagtttgattagg
agatcaacaccatcttcttttacttatatatgtgagaagaatggaggatctctcacagac
aaaatggatgaactagcatgctttgctccagggatgattgctttgggatcatttggttac
agtgctgctgatgattcacagaagtttctgtcacttgcagaagagcttgcttggacatgt
tataacttctaccaatcaactccaacaaaattggctggagagaactatttctttcattct
gggcaggacatgagtgtgggtacatcatggaacatactgaggccagagacagttgagtcc
ctcttttacctttggcgtctaactggcaacaaaacataccaagaatggggttggaatata
tttcaagcttttgagaagaactcccgcatagagtcaggctatgttggactgaaggatgtt
aatagtggagtcaaagacaacatgatgcaaagcttctttcttgcggagaccctgaagtat
ttttatcttctcttctcaccttcttcagtcatctcattagacgaatgggtattcaacaca
gaagcccaccctctgaggattgtgaccagacacgaagagggacttgttaagaatttaaat
gagaagcaaaaacctttttctagaataggtggcagaaaggaaggaaggtcaggttag

DBGET integrated database retrieval system