KEGG   Glycine max (soybean): 547702Help
Entry
547702            CDS       T01710                                 

Gene name
AMS1
Definition
(RefSeq) beta-amyrin synthase
  KO
K15813  beta-amyrin synthase [EC:5.4.99.39]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00909  Sesquiterpenoid and triterpenoid biosynthesis
gmx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    547702 (AMS1)
Enzymes [BR:gmx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.39  beta-amyrin synthase
     547702 (AMS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans Pec_lyase TED_complement BsuPI
Motif
Other DBs
NCBI-GeneID: 547702
NCBI-ProteinID: NP_001236591
UniProt: Q8H2B0
Position
7
AA seq 762 aa AA seqDB search
MWRLKIADGGNDPYIFSTNNFVGRQTWEFDPEAGSPEERAQVEAARQHFYHNRFKVKPCA
DLLWRFQVLRENNFKQTIPRVTIEDGEEITYQKVTSAVRRGAHHLAALQTSDGHWPAQIA
GPLFFLPPLVFCMYITGNLESVFPEEHRKEILRYTYYHQNEDGGWGLHIEGHSTMFCTAL
NYICMRMLGEGPNGGHDNACARARKWIRDHGGVTHIPSWGKTWLSILGVFDWCGSNPMPP
EFWILPSFLPMHPAKMWCYCRLVYMPMSYLYGKRFVGPITPLILQLREELFTQPYEKVNW
KKARHQCAKEDLYYPHPLIQDLIWDSLYIFTEPLLTRWPFNKLIREKALQVTMKHIHYED
ETSRYITIGCVEKVLCMLACWVEDPNGDAFKKHLARVPDYLWVSEDGMTMQSFGSQEWDA
GFAVQALLATNIIEEIGPTFAKGHDFIKKSQVKDNPFGDFKSMHRHISKGSWTFSDQDHG
WQVSDCTAEGLKCCLLLSMLPPEIVGEKMEPERLYDSVNVLLSLQSKKGGLAAWEPAGAQ
EWLELLNPTEFFADIVVEHEYVECTGSAIQALVLFKKLYPGHRKKEIENFITNAVRFLED
TQTADGSWYGNWGVCFTYGSWFALGGLAAAGKTYTNCAAIRKAVKFLLTTQREDGGWGES
YLSSPKKIYVPLEGSRSNVVHTAWALMGLIHAGQADRDPMPLHRAAKLLINSQLEEGDWP
QQEITGVFMKNCMLHYPMYRDIYPMWALAEYRRRVPLPSTEV
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggctgaagatagcagatggaggaaatgatccatacatattcagcacaaacaat
ttcgttgggaggcagacatgggagtttgatcctgaagcaggcagtccagaggaacgggcc
caggttgaagcagctcgtcagcatttctaccacaaccgcttcaaggtcaagccctgcgct
gacctcctttggcgttttcaggttctcagagaaaataacttcaaacaaacaattcctcgt
gtgactatagaagatggagaggaaatcacataccaaaaagtcacaagcgccgtcagaagg
ggcgcacaccaccttgcggcactgcagacctctgatggccattggcctgctcaaattgca
ggtcctctcttctttcttcctcctttggttttttgtatgtatattacaggaaatcttgaa
tcagtatttccagaagaacatcgcaaagaaattcttcgttacacatattatcaccagaat
gaagacggaggatggggactacacatagagggtcatagcactatgttttgtactgcactg
aactatatatgcatgcgaatgcttggagaaggacctaatggaggtcatgacaatgcttgt
gctagagcaagaaagtggattcgagatcatggtggtgtaacacatataccttcatgggga
aaaacttggctttcgatactcggtgtatttgattggtgcggaagcaacccaatgccccca
gagttttggatccttccatcttttcttcctatgcatccagctaagatgtggtgttactgt
cgattggtatacatgcctatgtcttacttatatgggaagaggtttgtgggtccaatcaca
ccactcatcttacaattaagagaagagttgtttactcaaccttatgaaaaagttaattgg
aagaaagcgcgtcaccaatgtgcaaaggaagatctttactatccccatcctttgatacaa
gacctaatatgggatagtttatacatattcactgaaccgctacttactcgttggcctttc
aacaagttgattagagaaaaggcccttcaagtaactatgaaacatattcattatgaagat
gagactagtcgatacataaccattggttgtgtggaaaaggttttatgtatgcttgcttgt
tgggtggaagatccaaacggagatgctttcaagaagcatcttgcaagggtcccagattac
ttatgggtttctgaagatggaatgaccatgcagagttttggtagccaagaatgggatgct
ggctttgctgttcaagctttgcttgccactaacataattgaagaaattggtcctacgttt
gcaaaaggacatgatttcatcaagaagtctcaggtgaaggataatccttttggagatttt
aaaagtatgcatcgtcatatttctaaagggtcttggacattctctgatcaagaccatgga
tggcaagtttctgattgcactgcagaaggtttaaagtgttgtctacttctatcaatgttg
ccaccagagattgtgggagaaaagatggaacctgaaagattatacgattcagtcaatgtc
ttgttgtcgcttcagagtaaaaaaggtggtttagcagcatgggagcctgcaggagctcaa
gagtggttagaattactcaatcccacagaattttttgcggacattgtagttgaacatgaa
tatgttgagtgcactggatctgcaatccaagctttagttttgttcaagaagctatatcca
ggacataggaagaaagagatagaaaatttcattaccaatgcagttcgattccttgaagat
acacaaacagctgatggttcatggtatggaaattggggagtttgcttcacttatggctct
tggtttgcacttggaggtctagcagctgctggtaagacttacaccaattgtgctgccatt
cgcaaagccgttaaatttctacttacaacacaaagagaggacggtggatggggagagagt
tatctttcaagcccaaaaaagatatatgtacctctagaaggaagccgatcaaatgttgta
catacagcatgggctcttatgggactaattcatgctggacaggcggatagagaccccatg
cctcttcaccgtgctgcaaagttgctcattaattctcagttggaagagggtgattggccc
caacaggaaatcacgggagtattcatgaaaaattgcatgttgcattatccaatgtacaga
gatatttatccaatgtgggctctagctgaatatcgaaggcgggttccattgccttccact
gaagtttaa

DBGET integrated database retrieval system