KEGG   Glycine max (soybean): 547923Help
Entry
547923            CDS       T01710                                 

Gene name
LOX1.1
Definition
(RefSeq) seed linoleate 13S-lipoxygenase-1
  KO
K15718  linoleate 9S-lipoxygenase [EC:1.13.11.58]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00591  Linoleic acid metabolism
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    547923 (LOX1.1)
Enzymes [BR:gmx01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.58  linoleate 9S-lipoxygenase
     547923 (LOX1.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipoxygenase PLAT
Motif
Other DBs
NCBI-GeneID: 547923
NCBI-ProteinID: NP_001236153
UniProt: P08170 B3TDK4
Structure
PDB: 

Position
13
AA seq 839 aa AA seqDB search
MFSAGHKIKGTVVLMPKNELEVNPDGSAVDNLNAFLGRSVSLQLISATKADAHGKGKVGK
DTFLEGINTSLPTLGAGESAFNIHFEWDGSMGIPGAFYIKNYMQVEFFLKSLTLEAISNQ
GTIRFVCNSWVYNTKLYKSVRIFFANHTYVPSETPAPLVEYREEELKSLRGNGTGERKEY
DRIYDYDVYNDLGNPDKSEKLARPVLGGSSTFPYPRRGRTGRGPTVTDPNTEKQGEVFYV
PRDENLGHLKSKDALEIGTKSLSQIVQPAFESAFDLKSTPIEFHSFQDVHDLYEGGIKLP
RDVISTIIPLPVIKELYRTDGQHILKFPQPHVVQVSQSAWMTDEEFAREMIAGVNPCVIR
GLEEFPPKSNLDPAIYGDQSSKITADSLDLDGYTMDEALGSRRLFMLDYHDIFMPYVRQI
NQLNSAKTYATRTILFLREDGTLKPVAIELSLPHSAGDLSAAVSQVVLPAKEGVESTIWL
LAKAYVIVNDSCYHQLMSHWLNTHAAMEPFVIATHRHLSVLHPIYKLLTPHYRNNMNINA
LARQSLINANGIIETTFLPSKYSVEMSSAVYKNWVFTDQALPADLIKRGVAIKDPSTPHG
VRLLIEDYPYAADGLEIWAAIKTWVQEYVPLYYARDDDVKNDSELQHWWKEAVEKGHGDL
KDKPWWPKLQTLEDLVEVCLIIIWIASALHAAVNFGQYPYGGLIMNRPTASRRLLPEKGT
PEYEEMINNHEKAYLRTITSKLPTLISLSVIEILSTHASDEVYLGQRDNPHWTSDSKALQ
AFQKFGNKLKEIEEKLVRRNNDPSLQGNRLGPVQLPYTLLYPSSEEGLTFRGIPNSISI
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atgttttcagcaggccataagatcaaagggacagtggtgttgatgcccaagaatgagttg
gaagttaaccctgatggctcagcagttgacaaccttaatgctttcttgggccgtagtgtc
tcccttcagctcattagtgctaccaaggctgatgcacatggaaaaggaaaagttggaaag
gatacgttcttggaagggattaatacttcgttaccaactttgggagcaggagagtctgca
ttcaatattcattttgaatgggacggaagcatgggaatccccggtgcgttttacataaag
aactacatgcaagttgagttcttcctcaagagtttgactcttgaagccatttcaaaccaa
ggaaccatccgctttgtttgcaactcatgggtttataacactaaactttacaaaagcgtg
cgcattttctttgccaaccatacatatgtacctagtgagacaccagcaccacttgtggag
tacagagaagaagaattgaagagtttaagaggaaatggaacgggagagcgcaaggaatat
gataggatctatgattatgatgtctacaatgatttgggcaacccagataagagtgaaaag
ttagctcgtccagttcttggagggtctagcacctttccctaccctcgtaggggaagaact
ggtcgaggtccaacagttacagacccgaatactgagaaacaaggcgaagtattttatgtt
ccaagagatgaaaatttaggtcacttgaagtctaaggatgctcttgagattggaacaaaa
tctttatctcaaattgtccagccggcgttcgaatctgcgttcgatttgaaatccacgcca
attgagtttcatagcttccaagatgtgcatgacttgtatgaaggtggaattaagcttcct
agagatgtaattagcacaattatccccttaccagtgatcaaagaactctatcgtaccgat
ggtcaacacatcctcaagtttccacaacctcacgtcgttcaagtgagtcagtctgcatgg
atgactgatgaagaatttgctagagagatgattgctggtgtaaatccctgcgtaattcgt
ggtcttgaagagttccctccaaaaagtaatctggatcctgcaatctatggtgatcaaagc
agtaagataacagcagattcccttgatctagatgggtacacaatggacgaggcacttggt
agtcgaaggttatttatgttagattaccatgatatcttcatgccatatgtgaggcagata
aatcagctgaattctgccaagacttatgcgacaaggactatcctttttttgagagaagat
ggaactttaaagccagtggccatcgaattaagtttgccacattctgctggggatctgtca
gctgccgtcagtcaagtcgtcttacctgctaaggaaggtgttgagagcacaatttggcta
ctagccaaagcttatgtcatcgtaaatgactcttgctaccatcaactcatgagccattgg
ttaaatactcatgcggcgatggagccattcgtcatagcaacacaccgacatcttagcgtg
cttcacccaatttacaagcttctgactcctcactatcgtaacaacatgaacatcaacgca
cttgccaggcaatctctaattaatgctaatggcataatagagacaacctttttgccctca
aagtattctgtggagatgtcttcggcggtttataagaattgggttttcactgatcaagca
ctacctgcagatcttatcaagagaggagtggcaattaaggatccatcaaccccacatgga
gttcgtcttctgatagaggactatccttatgccgctgatggactggagatatgggctgca
attaagacatgggttcaagaatatgtgcccttgtactatgcaagagatgatgatgtcaaa
aatgattctgaactccaacattggtggaaagaagctgtagagaaaggccatggtgatttg
aaagacaagccatggtggcctaagttgcagacacttgaagaccttgttgaagtttgcctc
attatcatatggattgcttcagctctccatgcagccgttaattttggtcagtatccttat
ggaggtttgataatgaaccgcccaactgcttctagaaggttgcttcctgagaaaggcacc
ccagaatatgaagaaatgattaataaccatgaaaaggcttatttgagaacaattacatca
aagttgccgactctcattagcctttcagtgatagagatcttgtcgacacatgcttctgat
gaggtctaccttggccagagggacaacccacattggacctctgattcaaaagcattacaa
gcctttcaaaagtttggaaacaagctcaaggaaattgaggaaaaacttgtgaggaggaac
aatgatccgagtctgcagggcaatcgacttggcccggttcaactgccatacactttgctt
tatcctagcagtgaggaagggttaacttttaggggaattccaaatagcatctctatctaa

DBGET integrated database retrieval system