KEGG   Glycine max (soybean): 548011Help
Entry
548011            CDS       T01710                                 

Gene name
CYSP1
Definition
(RefSeq) cysteine proteinase precursor
  KO
K16292  KDEL-tailed cysteine endopeptidase [EC:3.4.22.-]
Organism
gmx  Glycine max (soybean)
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:gmx01002]
    548011 (CYSP1)
Enzymes [BR:gmx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     548011 (CYSP1)
Peptidases and inhibitors [BR:gmx01002]
 Cysteine peptidases
  Family C1: papain family
   548011 (CYSP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Inhibitor_I29 Peptidase_C1_2 Cyc-maltodext_C
Motif
Other DBs
NCBI-GeneID: 548011
NCBI-ProteinID: NP_001237379
UniProt: Q7X750
Position
4
AA seq 362 aa AA seqDB search
MAMKKLLWVVLSLSLVLGVANSFDFHDKDLASEESFWDLYERWRSHHTVSRSLGDKHKRF
NVFKANVMHVHNTNKMDKPYKLKLNKFADMTNHEFRSTYAGSKVNHHRMFQGTPRGNGTF
MYEKVGSVPPSVDWRKNGAVTGVKDQGQCGSCWAFSTVVAVEGINQIKTNKLVSLSEQEL
VDCDTKKNAGCNGGLMESAFEFIKQKGGITTESNYPYTAQDGTCDASKANDLAVSIDGHE
NVPANDENALLKAVANQPVSVAIDAGGSDFQFYSEGVFTGDCSTELNHGVAIVGYGTTVD
GTNYWTVRNSWGPEWGEQGYIRMQRSISKKEGLCGIAMMASYPIKNSSNNPTGPSSSPKD
EL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgaagaagctcttgtgggttgtcctgtctctatctttggttcttggagtggcc
aatagctttgattttcacgacaaggatttggcgtccgaggaaagcttttgggacttgtac
gagagatggaggagtcaccacacggtttcgcgaagcctcggtgacaagcacaagcggttt
aacgtgtttaaagcaaatgtgatgcatgtccataacactaacaagatggataagccttac
aagctgaaactaaacaagtttgctgacatgaccaaccatgaatttaggagtacctatgct
ggctcaaaggttaatcaccacagaatgttccaaggcacgccacgtgggaacgggaccttc
atgtatgagaaggttggtagtgttcctccttctgtggattggaggaagaatggtgctgtc
actggtgtaaaagatcaaggccaatgtggtagttgttgggcgttttcaactgttgtagct
gttgaaggcattaaccaaatcaagacaaataagctagtctccttgtctgaacaagagctg
gtggactgtgacaccaaaaaaaatgcaggatgcaatggtgggttaatggaatctgctttt
gagttcatcaagcagaagggaggcataacaacagaaagcaattacccttacacagcacaa
gatggaacctgcgatgcatcaaaggcaaatgacctagctgtatcaattgatggccatgag
aatgtccctgctaacgacgaaaatgcattgctcaaagctgttgccaaccaacctgtctct
gtagccatagatgctgggggatctgattttcaattctactctgagggagtatttactggt
gattgtagcacggagctaaatcacggtgtagcgattgtagggtatggaacaactgttgat
gggactaattactggacagtgaggaactcttggggaccagaatggggagaacagggttac
atcagaatgcaaaggagcatatctaagaaggagggactttgtggcatagctatgatggct
tcctacccaatcaaaaactcctccaataatccaacaggaccctcatcatctcctaaagat
gaactttga

DBGET integrated database retrieval system