KEGG   Glycine max (soybean): 732562Help
Entry
732562            CDS       T01710                                 

Definition
(RefSeq) plastid division regulator MinE
Organism
gmx  Glycine max (soybean)
SSDB OrthologParalogGFIT
Motif
Pfam: MinE
Motif
Other DBs
NCBI-GeneID: 732562
NCBI-ProteinID: NP_001236997
UniProt: Q45RR9
Position
2
AA seq 232 aa AA seqDB search
MAISGDLRVSATLPLYRSHSPPLRTSSQSSPKVDFHRFLNRACSISEFTPKCPYLTIVRC
NMRGYCKPVAAVLGGPKFTSNSVSQETENFLLDAVKMNFFERLNLAWKIIFPSATSRKNS
NARIAKQRLKMILFSDRCEVSDEAKRKIVSNVVRALSDFVEIESQDKVQLSVSADTDLGT
IYSVTVPVRRVKPEYQEMDEFGTITNVEYKDTGETSGSVDVTFDFYVPDERS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcgatttccggcgatctcagagtctcagcaacacttcctctgtatcgctcccactcg
cctccactccgaacctcttctcagtcttccccaaaggtagactttcatcgtttcttgaac
agagcttgtagcatctctgaattcactccaaaatgcccttacctgacaattgtacgatgc
aatatgcgtgggtattgcaagccagttgctgcggtccttggaggtcctaaatttacatca
aattcagttagccaagaaaccgagaactttctccttgatgctgttaaaatgaacttcttt
gagcggttaaatttggcttggaagataattttcccatcggcaacatctagaaaaaactcc
aatgctaggattgctaagcaacgcttgaagatgattctgttctctgatcggtgtgaagta
agtgatgaggcaaagcgaaaaattgttagcaatgttgtgcgtgctctatcagattttgtg
gaaatagaatcacaggataaagttcagctgagtgtctctgctgatacagatcttggaact
atttactctgtcacagtgcctgtacggcgggttaaaccagaatatcaagaaatggatgaa
tttgggacaataacaaatgttgagtataaggacaccggagagacttctggttctgttgat
gttacatttgatttctatgttccagacgaaaggtcttga

DBGET integrated database retrieval system