KEGG   Glaciecola nitratireducens: GNIT_0113Help
Entry
GNIT_0113         CDS       T01632                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00071  Fatty acid degradation
gni00072  Synthesis and degradation of ketone bodies
gni00280  Valine, leucine and isoleucine degradation
gni00310  Lysine degradation
gni00362  Benzoate degradation
gni00380  Tryptophan metabolism
gni00620  Pyruvate metabolism
gni00630  Glyoxylate and dicarboxylate metabolism
gni00640  Propanoate metabolism
gni00650  Butanoate metabolism
gni00900  Terpenoid backbone biosynthesis
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01120  Microbial metabolism in diverse environments
gni01130  Biosynthesis of antibiotics
gni01200  Carbon metabolism
gni01212  Fatty acid metabolism
gni02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GNIT_0113
   00630 Glyoxylate and dicarboxylate metabolism
    GNIT_0113
   00640 Propanoate metabolism
    GNIT_0113
   00650 Butanoate metabolism
    GNIT_0113
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GNIT_0113
   00072 Synthesis and degradation of ketone bodies
    GNIT_0113
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GNIT_0113
   00310 Lysine degradation
    GNIT_0113
   00380 Tryptophan metabolism
    GNIT_0113
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GNIT_0113
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GNIT_0113
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GNIT_0113
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gni04147]
    GNIT_0113
Enzymes [BR:gni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GNIT_0113
Exosome [BR:gni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GNIT_0113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: AEP28267
UniProt: G4QIS8
Position
128482..129681
Genome map
AA seq 399 aa AA seqDB search
MQDAYIYDAARTAFGRHAGVLSSVRPDDMLAHLIKTLVQRNDFDLALYEDVIAGNTNQAG
EDSRNVARTAGLLAGLPIETGGLTVNRLCGSSLAAALDAARCVKANEGELFVACGVESMS
RAPFVLAKATSPFARQQEMFDTTMGARFTNPEIIKQFGAHSMPETADNIASDLDISREES
DVFAAASQAKYEAARVAGYFDDEIIPIEVSQGRNKPAISVATDEHPRPSSTLDALGQLKP
LFGGVVTAGNASGINDGASAMIIGSKNVGEQAGVKARGRIIAGAIAGVPPRVMGLGPVPA
SKKALARAGLTLADMDVLEFNEAFAVQALGCMKELGIAFDDPRVNQNGGAIAIGHPLGAS
GTRIMLTALRQLERTGGRYALATMCIGIGQGIAVVIERV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatgcctatatttatgatgctgcaagaaccgcatttggacgtcatgcaggcgta
ttatcctctgttcgaccagacgatatgctcgcacatcttattaaaaccttagtgcaacgc
aacgattttgatttagccctgtatgaagatgtgattgctggtaataccaatcaggccggt
gaagatagtcgaaacgtcgctcgtactgctgggcttttagctggcttacccattgaaacc
gggggcttaacggttaaccgtttgtgtggttcaagtttagcggcggctttagatgcagcg
cgatgtgttaaagccaatgaaggtgagttatttgttgcctgtggcgttgagtctatgagt
cgagcgcctttcgttttagcaaaagcaacttcaccttttgctcgccagcaagaaatgttt
gataccaccatgggtgcgcgatttactaaccccgaaattattaagcagtttggcgcccat
tccatgcctgaaacggcagacaacattgctagcgacctcgatataagcagagaagagagt
gatgtgtttgcagccgcctcgcaagccaaatatgaagcggctcgagtcgcgggatatttt
gacgatgaaattattcctattgaagtgtcgcaaggtcgtaataagccagcaattagcgtg
gcaacagatgagcatccaaggccatcttcaacactagatgcgctcggacaactaaagcca
ttgtttggtggggtggttaccgcgggtaacgcttcaggcattaacgatggtgcttccgct
atgataattggtagcaagaatgtgggtgaacaagcaggtgtcaaagctcgcggtagaatt
attgcaggcgccattgctggagtgccaccccgcgttatgggcttaggaccggttcctgca
tcaaaaaaagcactagccagagcgggtctaaccctagcagatatggatgttctagaattt
aatgaggcctttgcggtgcaagctttaggctgtatgaaagagcttggtattgcgtttgac
gaccctcgcgttaatcaaaatggtggtgcgatcgcgattggtcatcctttgggggcgagc
ggtacgcgcattatgctcaccgcattacgtcagttagaaagaacaggcgggcgctatgca
ttagccacgatgtgtattggtattggtcaaggtatcgccgtcgttattgagcgtgtatag

DBGET integrated database retrieval system