KEGG   Glaciecola nitratireducens: GNIT_0230Help
Entry
GNIT_0230         CDS       T01632                                 

Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00071  Fatty acid degradation
gni00072  Synthesis and degradation of ketone bodies
gni00280  Valine, leucine and isoleucine degradation
gni00310  Lysine degradation
gni00362  Benzoate degradation
gni00380  Tryptophan metabolism
gni00620  Pyruvate metabolism
gni00630  Glyoxylate and dicarboxylate metabolism
gni00640  Propanoate metabolism
gni00650  Butanoate metabolism
gni00900  Terpenoid backbone biosynthesis
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01120  Microbial metabolism in diverse environments
gni01130  Biosynthesis of antibiotics
gni01200  Carbon metabolism
gni01212  Fatty acid metabolism
gni02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GNIT_0230
   00630 Glyoxylate and dicarboxylate metabolism
    GNIT_0230
   00640 Propanoate metabolism
    GNIT_0230
   00650 Butanoate metabolism
    GNIT_0230
  Lipid metabolism
   00071 Fatty acid degradation
    GNIT_0230
   00072 Synthesis and degradation of ketone bodies
    GNIT_0230
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GNIT_0230
   00310 Lysine degradation
    GNIT_0230
   00380 Tryptophan metabolism
    GNIT_0230
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GNIT_0230
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GNIT_0230
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GNIT_0230
Enzymes [BR:gni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GNIT_0230
Exosome [BR:gni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GNIT_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEP28384
UniProt: G4QF40
Position
complement(261589..262773)
Genome map
AA seq 394 aa AA seqDB search
MSVNSVVVLSAVRSAVGTFSGSLSSIEPAELAGQVLTQGIAASGVEADKYESIIMGNTIP
TESRFPYVARVASIQAGMSLNSTAMALNRLCSSGLQAVVSSAQGIMLGDHELAIGGGVEN
MSRGGYLSPAMRAGARMGDSSMIDMMVATLTDPFGVGHMGITAENLASKWDISREQQDAF
AAMSHARAHAAIEAGYFTSQIVPVELKSRKGSTFFEVDEHVKPGTTAESLAGMRPAFKKD
GSVTAGNASGINDGASFLTLASENYANSNNLAPIARIVSYAVAGVPNDVMGEGPIPASKA
ALIKAGLTIAQMDVVESNEAFAAQALTVAKGLDLDPAKTNPNGGAIALGHPIGASGAVIA
TKAIHELHRTGGKYALVTMCIGGGQGIAVIFERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaaatagcgttgtagtattaagtgccgttcgttcagcagtaggcaccttcagt
ggcagtttaagttccattgaaccagcagaactcgctgggcaagtcctaacacaaggcatt
gcagcttcaggcgttgaggctgacaaatacgaatcaatcatcatgggtaatactattcca
accgaatcacgctttccgtatgttgcgcgcgtggcgtcaattcaggctggaatgtcactt
aattcaaccgcaatggccttgaatcgcttatgcagttcaggtttgcaagcggttgtaagc
tcggctcaaggcattatgctcggcgatcatgaacttgctatcggtggtggcgttgaaaat
atgtcccgcggtggttatttatctccggctatgcgtgcaggagcccgaatgggtgacagc
agcatgattgacatgatggtggcaactcttaccgatcctttcggtgttggccacatgggc
attactgcagagaacttagcatcaaaatgggacattagccgagagcagcaggatgctttc
gctgcaatgtctcatgctcgcgctcatgcggcgattgaagcaggttactttactagtcaa
attgtaccggtagaattgaaaagccgtaaaggcagcacgtttttcgaagttgatgaacat
gttaagccaggtactacagcagaatcgcttgccggaatgcgcccagcgtttaaaaaagac
ggcagtgtaacggctggtaatgcatcaggtattaatgacggcgcatccttcttaactcta
gcaagtgagaactacgctaatagcaataatcttgctccaattgctagaatagtatcttac
gcagttgctggtgtacctaatgatgttatgggtgagggccctattccagcttcaaaagct
gcgttaatcaaagccggtttaacgattgcccaaatggacgtagttgagtcaaacgaagcg
tttgcagcacaagccctaaccgtggcgaaaggcttagatctcgaccctgcaaaaacgaat
ccgaatggcggagcgatcgctttaggtcatcctattggcgcatcaggcgcagttattgcc
actaaagccatacatgaactccatcgtacgggtggtaaatatgcacttgttacgatgtgt
ataggcggcggacagggtattgcggtaatttttgaacgtttataa

DBGET integrated database retrieval system