KEGG   Glaciecola nitratireducens: GNIT_0245Help
Entry
GNIT_0245         CDS       T01632                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00220  Arginine biosynthesis
gni00250  Alanine, aspartate and glutamate metabolism
gni00471  D-Glutamine and D-glutamate metabolism
gni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GNIT_0245
   00220 Arginine biosynthesis
    GNIT_0245
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    GNIT_0245
Enzymes [BR:gni01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     GNIT_0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AEP28399
UniProt: G4QF55
Position
complement(275985..276905)
Genome map
AA seq 306 aa AA seqDB search
MQSIINDIAEQMAQSPDKGIVASYIPQLAKIDPNQFAISVALPNGEIYSAGCAQTTFSIQ
SVSKVFTLTLALGKLGESIWSRVGREPSGDPFNSIVQLEHEHGKPRNPFINAGAIAVADA
IMQGHQPKETLAEIVQFIRFLANDESIVIDEKVARSEVETGTRNASLAYFMASFGLFENS
VDAVLGTYFHHCSIAMNTHQLATAGLFLANNGINPSTGYAVVSPQRAKRINALMLTCGHY
DGSGEFAFRVGLPGKSGVGGGILAIAPGKASIAVWSPGLDVIGNSKLGTEALELFASKTG
WSVFGQ
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatcgatcattaacgatatagccgagcaaatggcgcaatcaccagacaaaggcata
gttgcttcctacattcctcaacttgcgaaaatcgatccaaatcaatttgccattagtgtt
gcgctcccaaatggagaaatatatagcgccggctgcgcgcaaacgacattttctattcag
agcgtttcaaaagtatttaccctcacactcgcccttggcaagttaggggagagtatttgg
tcacgtgttggccgagagccttccggcgacccatttaactctatcgtgcagttggagcat
gagcatggcaagcctcgtaatccgtttattaatgctggcgcgattgccgttgcagacgct
attatgcagggccatcagcccaaagaaaccttagctgaaatagttcagttcatccgcttt
ttagccaacgatgaaagtattgttattgatgagaaagtggcgcgctctgaggttgaaaca
ggcacgcgaaatgcttcattagcctatttcatggcgtcatttggtctgtttgaaaattct
gtagatgccgtactaggcacctactttcatcattgttcaatagcgatgaatacgcatcaa
ttagccacagcaggcttattcttggcgaacaatggtattaatccaagtacgggttatgct
gtcgtgtcaccgcaacgcgctaaacgtatcaatgcactgatgttaacgtgcggccattac
gacggttcaggtgagttcgcctttagagttggcttaccgggcaaaagtggggtcggcggc
ggaatattagcaattgcgccaggcaaggcatcaattgccgtttggtcacccggcttagat
gttatcggcaatagcaaacttggcactgaggcacttgaactatttgcgtctaaaaccgga
tggtctgtatttggccaatga

DBGET integrated database retrieval system