KEGG   Glaciecola nitratireducens: GNIT_1387Help
Entry
GNIT_1387         CDS       T01632                                 

Gene name
pycB
Definition
(GenBank) pyruvate carboxylase subunit B
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00620  Pyruvate metabolism
gni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GNIT_1387 (pycB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gni02000]
    GNIT_1387 (pycB)
Enzymes [BR:gni01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     GNIT_1387 (pycB)
Transporters [BR:gni02000]
 Other transporters
  Primary active transporters [TC:3]
   GNIT_1387 (pycB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA
Motif
Other DBs
NCBI-ProteinID: AEP29511
UniProt: G4QL40
Position
complement(1508429..1510474)
Genome map
AA seq 681 aa AA seqDB search
MQSTGIWTFETNAITRLVEQAAHVGFSSLEIGGGQSYQIALQQGYNPYNILRIARTAVDK
TGKTLPLQILLRGANQLGFKHYPKSLQQKNIDLLVDAGSTYDKTDSLIVRNFDALNDYEN
LRASIDYMVRKDLAAAQVNQALIAKGESPTAKRLHVQAALSYVRPKDFDALSCYSTDYYI
AYAKKLMDIAEAAGGQLDSIAIKDMSGQLAPDCAKHLISALKALGLPVFLHCHSTDEAKA
TATQMLAVEAGIDGIEVAIAPLAGGTSHNDINYLIHGNTIQDIDTEALATLHTTMNDIYG
NRVSERQDLKISLEALKRMVSIGVPGGAIPFILEDMSTQVCRMLNVTMETALDMFEQEII
AIQKQLGHVPLVTPTADIVAKQAINNLGNSARPTAYKVIDPRFCSLVLGLYGNVNNYATG
DKIVPSDSLINEINDYCSNIEPDIDGKRINGVTVYPNPGRIATGKHPTQSAIEEDYDLFE
DYVNELHRLYPHSSNNYGSHDECFVLHVMRPAGKTDRLLTKNILRPTEDRLRFILKVTLS
LLPGNDIPESRDGKADEKTDSKLLNALGDYDGIVSTIQDLVLSGTKDTIRSRLYDKMAKI
VEPICEESEDAQKNRYFVERRFLSLFASAVFWDLQRVCRRTGNSSRDDIEERTAFKLERI
IAFTLRKRVVEGRGKAESFLS
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcgactggaatatggacatttgaaaccaatgcaattactcgcttagtggagcaa
gctgcacatgttggtttcagcagcttagagattggcggtggccaaagctatcaaatagca
ctgcaacagggatacaacccctacaacattctacgtatagccagaacggcagtcgataaa
acaggcaaaacgctgccacttcaaatattacttcgcggcgctaatcaacttggatttaaa
cattacccaaagagcttgcagcaaaaaaacatcgatttactggtcgacgctggtagcacc
tacgataagaccgactccttaatcgtcagaaactttgatgccttaaatgactatgaaaat
ttgcgcgcatctatagattacatggtgcgtaaggacttagcagcagcacaagtaaaccaa
gcacttatcgcaaaaggtgaaagccccacagctaaacgattacatgttcaggcagcactt
tcttatgtaaggccaaaagatttcgatgcactttcctgctatagcaccgattactacata
gcctacgccaaaaaactaatggacatagcagaagctgcaggagggcaactagactcaatc
gctatcaaagatatgagcggccagttagcaccggactgcgcaaagcacctgatctcagca
ttaaaagccttaggcctgcctgttttccttcattgccacagcacggatgaggcgaaagca
accgccacacaaatgctcgccgttgaagctggtatcgatggtatagaagttgcgattgcg
ccattagcaggaggcacctcgcataacgatatcaactatttaattcatggcaatactata
caagatattgacaccgaagcgcttgcaacactgcataccaccatgaatgacatctatggt
aaccgcgttagcgaacgccaagatcttaaaatatcgcttgaagccctgaagcgtatggta
agcatcggtgtgccgggtggcgcaattccgtttatcttagaagatatgagtacgcaagtt
tgtcgcatgcttaatgtgaccatggaaactgcactggatatgttcgagcaagaaatcatt
gctattcaaaagcagctaggccatgttccattggttacgccaacggcagacatcgtcgcc
aaacaagcaattaataaccttgggaattcagccagaccaactgcctataaagtgatagac
ccgcgcttttgctctcttgttttagggctttatggcaatgtaaataactacgctactggc
gataagattgttccttcagacagtctaatcaatgaaattaacgactactgcagtaatatc
gagcctgatatcgatggcaaacgtatcaacggggttacggtatatccaaatccaggccgc
atcgccacaggtaagcaccctacccaatccgcaattgaagaagattacgatttgttcgag
gactacgtaaacgagctccatcgcctctacccacattcgtcaaataattacggtagtcat
gatgaatgcttcgtattacatgttatgcgcccagcgggtaaaactgaccgtttgctaaca
aaaaatattttacgacctacagaagacagactgcgctttattcttaaagtgacactcagc
ctgttgccgggtaacgacattcccgaatcacgcgatggcaaagcggacgaaaagaccgac
tccaagctattgaacgctcttggcgactacgatggtattgtcagcactatccaagacctt
gttctttccggtacaaaagacactattcgctcgcggctttatgacaaaatggcaaaaatt
gtcgaaccaatatgcgaagaaagtgaagatgcacaaaagaaccgctattttgttgaacga
cgctttctctcgctattcgcgagtgcggtattttgggatctacaacgtgtatgtcgacgt
accggtaactcttctcgtgacgacattgaagaacgaacagcgttcaagctagagcgtatt
attgcattcacattgcgtaaacgcgttgttgaaggtcgtggcaaagcggaaagtttttta
agttaa

DBGET integrated database retrieval system