KEGG   Glaciecola nitratireducens: GNIT_2027Help
Entry
GNIT_2027         CDS       T01632                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00020  Citrate cycle (TCA cycle)
gni00640  Propanoate metabolism
gni00660  C5-Branched dibasic acid metabolism
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01120  Microbial metabolism in diverse environments
gni01130  Biosynthesis of antibiotics
gni01200  Carbon metabolism
Module
gni_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gni_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GNIT_2027 (sucC)
   00640 Propanoate metabolism
    GNIT_2027 (sucC)
   00660 C5-Branched dibasic acid metabolism
    GNIT_2027 (sucC)
Enzymes [BR:gni01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GNIT_2027 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEP30136
UniProt: G4QLN0
Position
complement(2245220..2246386)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFKEYGLPVSEGYAAETPQAAVEAADRIGGTEWVVKCQVHAGGRGKAGGV
KLVKDKADIRAFAENWLGKNLVTYQTDENGQPVSQILVETCTDIAQELYLGAVVDRTSRR
IIFMASTEGGVEIETVAEETPEKILKAEIDPLVGAQPFQAREIAFKLGLKGVQIRQFTTI
FMGLAKMFEELDLAMIEINPLVIKADGDLHCLDAKLGVDGNALYRQPKVRDMNDPSQDDA
REAHAAKFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGSPANFLDVGGGATKERVAE
AFKIILSDSKVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVNVPVVVRLEGTNAELGREV
LAGSGLDIIAAESLTDAALKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccagggcaaacagttattcaaagaatacggtttgccagtatct
gaaggatacgctgctgagactcctcaagctgctgttgaagctgcagaccgcattggcgga
actgaatgggtagttaaatgtcaagtacacgctggcggtcgcggtaaagcgggcggtgtg
aaactagttaaagataaagcagacatcagagctttcgctgaaaactggcttggtaaaaac
ctagtcacttatcaaacagacgaaaatggtcagccggtcagtcaaattcttgttgaaacc
tgcacagatatcgcgcaagagctttacttaggcgcagtggttgatagaacatcacgccga
atcattttcatggcatctactgaaggtggcgttgaaattgagactgttgctgaagaaaca
ccagaaaaaatcttgaaagcggaaattgatccacttgtcggcgctcagcctttccaagct
agagaaatcgcattcaagttaggtttgaagggtgttcaaattcgtcagttcaccacaata
tttatgggtctagctaagatgtttgaagagcttgacctagcgatgattgaaattaaccca
ctagtgattaaagcagatggcgatttacattgcttagatgcgaaattaggtgttgatggc
aatgcattgtatcgtcagccaaaagttcgcgacatgaacgatccatcacaagatgacgct
cgtgaagctcatgcagcaaaattcgaattgaactatgttgcactagacggcaatgttggc
tgcatggttaacggtgctggtcttgcaatgggaacgatggatatcgttaacctgcatggc
ggtagccctgctaacttcctcgatgttgggggcggtgcaaccaaagaacgtgttgctgaa
gcatttaaaatcattttgtcagacagcaaggttaaagccgtattggtcaacatcttcggt
ggtatcgtgcgttgcgatatgattgctgaaggtattatcggtgcagttaaagaagttggc
gttaacgtgccagtggttgttcgtcttgaaggcacaaatgcagaactaggccgtgaagta
cttgcgggttctggtttagatatcattgctgcagaatcattgacggatgctgcacttaaa
gttgttgctgctgcggagggcaaataa

DBGET integrated database retrieval system