KEGG   Glaciecola nitratireducens: GNIT_2480Help
Entry
GNIT_2480         CDS       T01632                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00040  Pentose and glucuronate interconversions
gni00052  Galactose metabolism
gni00500  Starch and sucrose metabolism
gni00520  Amino sugar and nucleotide sugar metabolism
gni01100  Metabolic pathways
gni01130  Biosynthesis of antibiotics
Module
gni_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GNIT_2480
   00052 Galactose metabolism
    GNIT_2480
   00500 Starch and sucrose metabolism
    GNIT_2480
   00520 Amino sugar and nucleotide sugar metabolism
    GNIT_2480
Enzymes [BR:gni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     GNIT_2480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEP30577
UniProt: G4QM06
Position
complement(2730676..2731563)
Genome map
AA seq 295 aa AA seqDB search
MSQVKKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVNECVQAGIKQIILVTHAS
KNSIENHFDTSFELEATLEKRVKRQLLDAVKAICPKDVTIMHVRQGVASGLGHAIMCAYP
LIGDEPFAVVLPDVIIDDVASNLKKDNLADMVAKFNTSRVSQVMVEKVAEEDVSKFGIVD
LEGKELAPGESCKMFRMVEKPDLEEAPSNLAVVGRYVLSEKTWDLLAKTPPGAGGEIQLT
DAIDALMEHEQVDAYYMKGKSHDCGSKLGYMKANVEYAMRHPELGVEFTEYLKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagtgaaaaaggcagtaatacctgtagctggtttgggaacaagaatgctacca
gcgacaaaagcgataccaaaggaaatgctgccggtagttgataagcctcttattcagtac
gtggtgaatgagtgtgtgcaagcgggtattaagcaaattattctagtgactcacgcgagt
aagaatagtattgaaaaccactttgatacatcgttcgaactggaagccaccctagagaag
cgtgttaaacgccagcttctcgatgcagttaaagctatttgccctaaagatgtaacgata
atgcacgtgcgtcaaggcgttgccagtggccttggtcatgcaattatgtgtgcataccca
ctgattggtgacgaaccctttgctgttgtgctacctgacgtaatcattgacgatgtagca
agtaacctcaaaaaagacaatcttgctgatatggtcgcgaagtttaacaccagtcgcgtt
agccaagtaatggttgaaaaagtggctgaagaagacgtatctaaatttggtattgtcgat
ttagaaggaaaggagctcgcccctggtgagtcttgcaagatgtttagaatggttgaaaaa
cctgatttagaagaggctccctctaatttagccgttgtaggtcgttatgttctatctgaa
aaaacatgggatttattagccaaaacgcctccaggtgctggcggtgaaattcagttaact
gacgctattgatgcacttatggagcacgagcaagttgacgcatactacatgaaaggcaaa
agccatgattgtggtagtaaacttggttacatgaaagctaacgtagaatacgcaatgcgt
catcctgagttaggtgtggagtttactgagtatttgaaaacgttgtag

DBGET integrated database retrieval system