KEGG   Glaciecola nitratireducens: GNIT_2818Help
Entry
GNIT_2818         CDS       T01632                                 

Gene name
folK
Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00790  Folate biosynthesis
gni01100  Metabolic pathways
Module
gni_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GNIT_2818 (folK)
Enzymes [BR:gni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     GNIT_2818 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK Sua5_yciO_yrdC
Motif
Other DBs
NCBI-ProteinID: AEP30915
UniProt: G4QMG3
Position
complement(3127085..3127597)
Genome map
AA seq 170 aa AA seqDB search
MQLVPHFILISVGSNIDKAANTDAGLNGLNKAFDGIQLSPVYESESVGFKGDTFFNLVVS
ASTNKSIARVCEILKQIEDENGRVRGSEKFAPRTLDLDLLTYDDTVIDNPIVLPREEILY
NAFVLRPLADLVPQHMHPLVKKTYQSLWQQYDKQKQNLWVADYTWSKTKT
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagtgccgcatttcatacttattagtgttggctctaacattgacaaagcggcg
aataccgatgctgggctcaatggcttaaataaggcctttgatggcatacaactctcacct
gtttacgaaagtgagtctgttggtttcaaaggagacaccttctttaatctagtggtgtcg
gcgagtacgaataaaagcatcgctcgcgtttgtgaaattttaaaacaaattgaagatgaa
aacggtcgcgtgcgcggctcggaaaagtttgcccctcgcacattagacttggatttactt
acgtatgatgacactgtcatcgataacccgattgttttacctcgcgaagaaattctctat
aatgcttttgtgttaaggccgttagcggatttggtaccacagcacatgcatcccttggta
aagaaaacatatcaatctttatggcagcagtacgacaaacaaaaacagaatttgtgggtt
gctgactatacatggagcaagacgaaaacatga

DBGET integrated database retrieval system