KEGG   Glaciecola nitratireducens: GNIT_2866Help
Entry
GNIT_2866         CDS       T01632                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00010  Glycolysis / Gluconeogenesis
gni00020  Citrate cycle (TCA cycle)
gni00620  Pyruvate metabolism
gni01100  Metabolic pathways
gni01110  Biosynthesis of secondary metabolites
gni01120  Microbial metabolism in diverse environments
gni01130  Biosynthesis of antibiotics
gni01200  Carbon metabolism
Module
gni_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GNIT_2866
   00020 Citrate cycle (TCA cycle)
    GNIT_2866
   00620 Pyruvate metabolism
    GNIT_2866
Enzymes [BR:gni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GNIT_2866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C InvH
Motif
Other DBs
NCBI-ProteinID: AEP30963
UniProt: G4QML1
Position
complement(3174142..3175413)
Genome map
AA seq 423 aa AA seqDB search
MKTLTMPSFGSDMATGTLAQWHVKVGDNVSKGDIVATIETMKGLIDMEVFDDGVIDSLSA
SEGEELNIGAPIAQLRLLSENDENTNVIEKPSSDTSENLKTNLDTASQNKALPKERELNT
KSQRVETDSKLSQQNEIIETDKPLAISPAARKRAADLGVNWRQISHGQGPDGAIILQDID
DTFSMTVDSSAKSKSTKPKSTPAEMMRQAIAANVSRSKREIPHYYLQLDVALDKALDCLS
AHNADLPPSKRVLVNAMIYCAIARALVDFPAFNGFYNDDQYQPSETVHLGHAISLRTGGL
MIAAIRDAQGLGTIELMDKLRDQVTRAREGGLRMSEVTEASVTISSIGDRGADSMQNIIF
PPQVSIFGLGRSRKMPWVIDDAIVAATIVTISLAADHRVSDGHSGARLLNKINKLLQTPE
RLI
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacttactatgccttcttttggctcagatatggctacaggcacccttgcacaa
tggcatgtgaaagtcggtgataatgtgtcaaagggagatatcgttgcaaccatcgaaacc
atgaaagggcttatagatatggaggtgtttgacgatggtgtcattgattctctgtcggcc
tcagaaggtgaagaacttaatattggcgctcctatcgctcagttacggttgcttagtgaa
aatgatgaaaacacaaatgttatagaaaaaccaagtagtgatacatctgagaatcttaaa
acgaatctcgatacagcatcacaaaataaggcattgcctaaggaacgagaactgaacaca
aagagtcagcgcgttgaaactgacagcaaattaagccaacaaaacgaaataatagaaaca
gataaacccctagctatttctccagcggcgagaaaacgtgcagcagatcttggtgttaat
tggcgtcaaataagtcatggacagggccctgacggcgcgattattctgcaagacattgat
gatacatttagcatgacagttgattcgtctgcaaaatcgaaatccacaaaacctaagtct
acacccgctgaaatgatgcgccaagccattgccgctaacgttagccgttcaaaacgcgag
atacctcactattatttacaacttgatgttgcattagataaggcgcttgactgtttaagt
gcgcataacgctgacttacctccaagcaagcgagtattagttaacgctatgatttattgt
gctattgctcgcgcgttagtggatttccctgcttttaatggtttttataacgatgatcag
tatcaaccatctgaaacggtgcatttagggcatgcgattagtttgcgaacaggggggctc
atgattgctgcaattcgagatgcacaaggcttaggtacaattgagttaatggataagctc
agagatcaagtaactcgagcaagagaaggaggcctgaggatgtctgaagtaacagaggcc
agcgtgactatttcaagcattggggatagaggcgcagacagcatgcaaaatattattttt
ccacctcaagtttctatcttcggtctaggtagatcacgcaaaatgccatgggttatagat
gacgctattgttgctgccactattgttactatcagtttggccgcagatcaccgagttagc
gatggtcattcaggcgctcgtttattaaataaaatcaataaactcttacaaacccccgag
aggctaatatga

DBGET integrated database retrieval system