KEGG   Glaciecola nitratireducens: GNIT_3156Help
Entry
GNIT_3156         CDS       T01632                                 

Definition
(GenBank) aconitase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
gni  Glaciecola nitratireducens
Pathway
gni00640  Propanoate metabolism
gni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    GNIT_3156
Enzymes [BR:gni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     GNIT_3156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AEP31251
UniProt: G4QDX7
Position
3509785..3512373
Genome map
AA seq 862 aa AA seqDB search
MNYDYRKPLPNSQLDYYDTKEAVNNIQAGAYETLPYTSRVLAENLVRKCDPAILTDCLKQ
IIERKRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIAAKGGDPAQVNPVVPTQLVVDH
SLAVEHGGADKDAFTKNRAIEDRRNEDRFHFINWTKTAFKNIDVIPQGNGILHQINLERM
SPVVQARDGVAFPDTLVGTDSHTPMVDALGVIAIGVGGLEAESVMLGRASYMRLPDIIGV
ELTGKPQAGITATDIVLALTEFLRAQKVVSSFLEFYGEGTKHLTLGDRATISNMTPEYGA
TAAMFYIDRQTIDYLTLTGREDDQVKLVEQYAKHTGLWADDLVTAEYERVLSFDLSSVGR
NIAGPSNPHTRVSTADLAVKGISGVVENEEGKMPDGAVIIAAITSCTNTSNPRNMIAAGL
IARNANKLGLLRKPWVKSSLAPGSKAVQLYLEEAGLLPELENLGFGIVGFACTSCNGMSG
ALDPKIAEEIKQRDLYATAVLSGNRNFDGRIHPHANQAFLASPPLVVAYAIAGTIRFDIE
KDVLGKDAQGNDIRLMDIWPSDEEIDAVVKSSVKPEQFRKVYNPMFDLSVDYGEDNDPLY
AWRPQSTYIRRPPYWEGALAGERSMKGMRALAVLGDNITTDHLSPSNAIQMNSAAGEYLH
KMGLPEVDFNSYATHRGDHLTAQRATFANPRLKNEMAIVDGKMQEGSLTRIEPEGKVTRM
WEAIETYMQRKQPLIIVAGADYGQGSSRDWAAKGVRLAGVEVIAAEGFERIHRTNLIGMG
VLPLEFEAGTTRKTLGIDGTESFDVEGEPTPGATLHLVINRKDGEVIKVPMKCRLDTAEE
VSIYEAGGVLQRFAQDFLEATA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgattacagaaaacccctacccaacagtcagctagactattatgatacaaaa
gaagcggtcaataatatccaagcgggtgcctatgaaaccctgccctacacttcacgcgta
ttggctgaaaacttggttagaaaatgcgatccagcgatcctaactgattgcttaaagcaa
attatagagcgtaaacgtgatctcgacttcccgtggtttccagcacgcgttgtatgccat
gatattcttggccaaactgcgctcgtagatttagcaggattaagagatgcgattgcagcc
aaaggcggcgatcctgctcaggttaatcctgtagtaccaacacaattagttgtcgaccat
tcactggcggtcgaacatggaggcgccgacaaggacgcgtttactaaaaacagagcgatt
gaagatcgccgcaatgaagaccgtttccactttatcaattggacaaaaaccgcatttaaa
aatatcgatgttattccacaaggtaacggcatactgcatcaaattaacttagagcgcatg
tcacccgttgttcaagcacgcgacggtgtcgcttttcctgacaccttagtaggaaccgat
agccacacaccaatggttgacgcattaggcgttattgcgattggtgtgggtggtctggaa
gctgaaagcgttatgctaggacgagcgtcatatatgcgcctcccagatattattggtgtt
gaactaactggcaagccacaagctggcattacggcgactgacattgtgttggcactgaca
gagtttttacgtgcgcaaaaagtcgtttcgtcgttcttagagttttatggcgaaggcaca
aagcaccttaccctcggtgatcgtgcaactatctccaacatgacgccagagtacggcgct
actgcagctatgttttatatcgatagacaaactattgattacctaacacttactggtcga
gaagacgatcaagttaagcttgttgaacaatacgcaaagcatactggtttgtgggcagac
gatttagtaaccgcagaatacgagcgagtcttgagttttgatttgtcatccgttggacgc
aatattgctggtccttccaacccgcatactcgcgtatcgacagccgatttagctgtaaag
ggtattagcggagtggtagaaaatgaagaaggcaaaatgccggacggtgctgtgattatt
gccgctatcaccagttgtactaacactagtaatccgcgcaacatgattgcagccggctta
attgctcgcaacgctaataagctcggtttgctaagaaagccttgggtaaaaagttcttta
gcaccaggctctaaagctgtgcaactgtatttggaagaagcaggattgctgcctgaactc
gaaaatctaggctttggtattgtgggttttgcctgtacctcatgcaacggtatgagtggt
gcgcttgatcctaagattgcagaagaaatcaaacagcgcgatttatatgctacagcagtg
ttgtcaggcaatcgcaactttgacggccgtattcatccacacgctaatcaagcattttta
gccagtccgcctctcgtagtggcttacgctattgccgggactattcgtttcgatatagaa
aaggatgtattaggtaaagatgcacagggcaacgatatccgcttaatggacatttggcca
agcgacgaagaaattgatgccgttgtaaaatctagcgtcaaacctgagcaattccgcaag
gtttataatccgatgtttgatttgagcgtggattacggtgaagacaatgatccgctttac
gcttggcggccacaaagcacttatattcgtcgccctccatactgggaaggcgctttagca
ggcgagcgcagcatgaaaggaatgcgtgctttggccgtgttaggtgacaacatcactacc
gatcacttatcaccgtcaaacgcaatccaaatgaacagcgctgctggtgagtatttgcat
aaaatgggcttgcccgaagttgacttcaactcctatgcaacccatcgcggtgaccattta
accgctcaacgtgccacgtttgctaacccaagattgaagaatgaaatggcgatcgttgac
ggcaaaatgcaggaaggctcactcactagaattgagcccgaaggcaaagtgacacgcatg
tgggaagcaattgaaacgtacatgcagcgtaaacagccactcattatcgttgcaggtgct
gattatggtcaggggtcatctcgcgattgggcagcaaaaggtgtacgtttagcaggtgtt
gaagtcattgcagcagaaggttttgagcgcattcaccgcactaatttgatcggtatgggt
gtattaccgcttgagtttgaagcagggacaactcgtaaaacattgggtatagacggcact
gaaagcttcgatgtagaaggtgagccgacacctggcgcaacactccacttagtcatcaat
cgtaaagatggtgaggtcatcaaagtcccgatgaagtgccgcttagataccgcagaagaa
gtctcaatttacgaagcaggcggtgttcttcagcgttttgcacaagactttcttgaagct
accgcataa

DBGET integrated database retrieval system