KEGG   Geodermatophilus obscurus: Gobs_0234Help
Entry
Gobs_0234         CDS       T01163                                 

Definition
(GenBank) 1,4-beta cellobiohydrolase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00500  Starch and sucrose metabolism
gob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gobs_0234
Enzymes [BR:gob01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Gobs_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: ADB73039
UniProt: D2S411
Position
complement(244887..246155)
Genome map
AA seq 422 aa AA seqDB search
MKESVHYFTCMPVVTTAPPSTSGRHRPGRGRRLLWTSGLAAALVGTGLVTPLLTGPEATP
AAQPAIEQVRKVRPAPTTTAPAPAPAIASPTTSAPAPSSTTTAAPSTPASAAPTSSSAAG
APSTTTPAAPTSTAAPAPSTANPLAGMTFHGPNTGAALAAAQPGRSPEDAAALAQLAGVP
TATWLGAWSGDVTAAVRQEVTAARAAGAVPVLVTYNVPGRDCGGYSAGGVDSSAEYLRWV
QAVAAGIGTAQAVVVVEPDALALLCGDPAQRLSLLRSAVEVLEANAGTHTYLDAGHSTWI
DAATMAERLRAAGVTAADGFALNVSNFQTTASNVAYGHQVSSLLGGAHFVVDTSRNGNGP
GSDWCNPPGRALGERPTAQTGQPRVDAFLWVKRPGESDGTCNGGPAPGTFWDAYAIGLVR
GY
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggaatcggtccactactttacgtgcatgcccgtcgtcaccaccgcgccgcccagt
acctccggccggcaccggccaggtcgcggcaggcgactgctgtggacgtccgggctcgcc
gcggcactggtcggcaccggcctggtcacgccgctgctcaccggtcccgaggcgacgccg
gccgcgcagccggccatcgagcaggtccgcaaggtccgaccggcgccgacgacgacggct
ccggctccggctcctgccatcgccagccccacgacgagcgctcccgcgccgagcagcacg
acgaccgccgcgccctcgacgcccgcgagcgccgctccgacgagcagctccgccgccggt
gcgccgagcaccacgacgcccgccgcaccgacctcgaccgccgccccggccccctcgacg
gccaacccgctcgccgggatgaccttccacggccccaacaccggtgcggccctggccgcg
gcgcagccgggccgcagccccgaggacgccgcggcgctcgcccagctggcgggcgtgccc
acggcgacctggctgggggcgtggagcggagacgtcacggcggcggtccgccaggaggtc
accgccgcccgcgcggccggggccgtgccggtcctcgtcacgtacaacgtcccgggccgg
gactgcggcggctactcagccgggggcgtggactcgtcggccgagtacctccgctgggtg
caggcggtcgcggccggcatcgggaccgcgcaggcggtggtggtcgtcgagcccgacgcg
ctcgcgctgctgtgcggcgacccggcgcagcgcctgtcgctgctgcggtcggcagtcgag
gtgctcgaggccaacgccggcacccacacctacctcgacgccgggcactcgacctggatc
gacgccgcgacgatggccgagcggcttcgcgccgccggggtgaccgccgcggacggcttc
gcgctgaacgtctccaacttccagacgaccgcgagcaacgtggcctacggccatcaggtg
tcgtcgctgctgggcggcgcccacttcgtcgtggacaccagccgcaacggcaacggcccc
ggcagcgactggtgcaaccccccgggccgcgccctcggcgagcgcccgacggcgcagacc
gggcagccccgggtcgacgcgttcctgtgggtcaagcgacccggcgagtccgacggcacg
tgcaacggcggcccggcccccgggaccttctgggacgcctatgccatcgggctggtccgg
ggctactga

DBGET integrated database retrieval system