KEGG   Geodermatophilus obscurus: Gobs_0304Help
Entry
Gobs_0304         CDS       T01163                                 

Definition
(GenBank) acyl-CoA oxidase domain protein
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00071  Fatty acid degradation
gob00410  beta-Alanine metabolism
gob00592  alpha-Linolenic acid metabolism
gob00640  Propanoate metabolism
gob01040  Biosynthesis of unsaturated fatty acids
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Gobs_0304
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Gobs_0304
   00592 alpha-Linolenic acid metabolism
    Gobs_0304
   01040 Biosynthesis of unsaturated fatty acids
    Gobs_0304
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Gobs_0304
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     Gobs_0304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: ADB73105
UniProt: D2S4Z4
Position
complement(323297..325309)
Genome map
AA seq 670 aa AA seqDB search
MTTSLPHAVDPRTLTEVLDGRWGHVRHDARENLHDPDLLPVYGENVQEARERVTRMAEKI
AASGRVTLGFPKEYGGEGDAGGSVTAIEMLAFTDLSLMVKAGVQWGLFGGAVQALGTERH
HDAYLRDIMGFDLPGCFAMTETGHGSDVQQLRTTCTYDPGTRTFDLHTPHEAARKDYIGN
AAKDGRMAVVFAQLVTKGERHGVHAWLVPIRDEQGAPMPGVTIGDDGPKAGLLGVDNGRL
SFDHVTVPRDMLLDRYGQVAEDGTYTSSIENETRRFFTMLGTLVRGRVSVGGSAAAATKL
ALDIAVRYGQTRRQFSAPGADREVLLNDYLVHQRKLLPALAATYAYSFAQEELVGTMHDV
QGAEDLDEGAQRELESRAAGLKAAQTWHATRTIQTAREACGGAGYLQENRLPHLKADTDV
FTTFEGDNTVLLQLVAKGLLTGYRDAFGSLDGWGKVGFIADMVRETVLERTAARGLIARL
VDAVPGREDEVPLLDRGWQLKMLEDREKHLLEGAIRRLRRGAETPGARPFDVFNDVQDHV
LRTAQAHTDRIVLEAFVAGIERTTDAGAKALLERVCDLYALTTIEADRAWFLEHGRLTPN
RSKALTATVNGVLKELRPHLVTLVDAFAIPEDWKGAAILREEPARQEAMATGDAELRRGT
ATSVEVPPGQ
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgagcctgccgcacgcggtggacccgaggacgctcaccgaggtgctcgacggc
cgctggggccacgtccgccacgacgcgcgggagaacctgcacgacccggacctgctgccg
gtctacggcgagaacgtgcaggaggcccgcgagcgggtcacccggatggcggagaagatc
gccgcgtccggccgggtcacccttgggttccccaaggagtacggcggcgagggcgacgcc
ggcggctcggtcaccgcgatcgagatgctggccttcaccgacctgtcgctgatggtcaag
gccggcgtccagtgggggctgttcggcggcgccgtccaggcgctcggcaccgagcggcac
cacgacgcgtacctgcgcgacatcatgggcttcgacctgcccggctgcttcgccatgacc
gagaccgggcacggctccgacgtccagcagctgcggacgacgtgcacctacgaccccggg
acgcggaccttcgacctgcacacgccgcacgaggccgcgcgcaaggactacatcggcaac
gcggcgaaggacggccggatggcggtcgtcttcgcccagctggtcaccaagggcgagcgg
cacggcgtgcacgcctggctggtgccgatccgcgacgagcagggcgccccgatgcccggc
gtcaccatcggcgacgacggcccgaaggcggggctgctcggcgtcgacaacggccggctg
tccttcgaccacgtgaccgtgccgcgggacatgctgctcgaccggtacggccaggtcgcc
gaggacggcacctacaccagctcgatcgagaacgagacccggcgtttcttcaccatgctg
ggcaccctggtgcgcggccgggtgagcgtcggcggctccgcagcggcggccaccaagctc
gccctggacatcgccgtccgctacggccagacccgccggcagttctccgcgcccggcgcc
gaccgcgaggtcctgctcaacgactacctcgtgcaccagcgcaagctgctgccggccctg
gcggccacctacgcctactccttcgcgcaggaggagctggtcggcacgatgcacgacgtc
cagggcgcggaggacctcgacgagggcgcgcagcgcgagctggagtcccgggccgccggg
ctcaaggccgcccagacctggcacgccacgcggaccatccagacggcccgcgaggcctgc
gggggtgccggctacctgcaggagaaccggctgccgcacctcaaggccgacaccgacgtc
ttcaccaccttcgagggcgacaacaccgtcctgctgcagctggtcgccaagggcctgctc
accggctaccgcgacgccttcggctcgctcgacggctggggcaaggtgggcttcatcgcc
gacatggtccgcgagaccgtgctcgagcggacggcggcccgcggcctgatcgcccggctc
gtcgacgccgtccccggccgggaggacgaggtgccgctgctcgaccgcggctggcagctg
aagatgctcgaggaccgcgagaagcacctgctcgagggcgcgatccggcggctgcggcgc
ggcgcggagacccccggcgcccggcccttcgacgtcttcaacgacgtccaggaccacgtg
ctccggacggcgcaggcgcacaccgaccggatcgtgctggaggccttcgtcgcgggcatc
gagcggacgacggacgccggcgcgaaggccctgctcgagcgggtctgcgacctgtacgcg
ctcaccaccatcgaggccgaccgggcctggttcctcgagcacgggcggctcaccccgaac
cgctccaaggcgctcaccgccacggtgaacggcgtgctcaaggagctgcggccgcacctg
gtcacgctggtcgacgccttcgccatcccggaggactggaagggcgcggcgatcctgcgc
gaggagcccgcccgccaggaggccatggcgaccggtgacgccgagctgcgccgcgggacg
gcgacctcggtggaggtcccgcccggccagtga

DBGET integrated database retrieval system