KEGG   Geodermatophilus obscurus: Gobs_0337Help
Entry
Gobs_0337         CDS       T01163                                 

Definition
(GenBank) glycosyl transferase family 2
  KO
K13693  glucosyl-3-phosphoglycerate synthase [EC:2.4.1.266]
Organism
gob  Geodermatophilus obscurus
Brite
KEGG Orthology (KO) [BR:gob00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:gob01003]
    Gobs_0337
Enzymes [BR:gob01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.266  glucosyl-3-phosphoglycerate synthase
     Gobs_0337
Glycosyltransferases [BR:gob01003]
 Others
  Glycosylglycerate
   Gobs_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ADB73133
UniProt: D2S522
Position
complement(357343..358305)
Genome map
AA seq 320 aa AA seqDB search
MRPDVRRWLHSRTFAAETWAAPDLVAVKGTRGCTVSVVLPALDEERTVGTIVATIRDHLV
ERCPLVDEVVVVDSGSSDRTAEVAAAAGARVVAADTVLPRHGSRPGKGEALWKSLHVTSG
DLLVFIDADLVAFDPRFVVGLLGPLLTDPTVGYVKALYDRPLTTTDGIVPSGGGRVTELV
ARPLLNAFWPELAGFVQPLSGEYAGRRELLEQVPFVSGYGVELGLLVDLAALAGLDALAQ
VDFGTRQHTHQADAALGRMAGQILHTALARRPGAGRPKRELLQFLRTADGLEGVSWDVGV
VERPPMRSVRAVEGGRRGRA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacctgacgtccgacgctggctccactcccgcaccttcgccgccgagacctgggcg
gcacccgacctggtggccgtcaagggcacccgcggctgcaccgtcagcgtggtgctcccc
gccctcgacgaggaacgcaccgtgggcacgatcgtggccacgatccgcgaccacctcgtc
gagcgctgcccgctggtcgacgaggtggtcgtcgtcgacagcggctccagcgaccggacg
gcggaggtggcggcagcggccggcgcccgcgtcgtcgccgccgacacggtgctcccccgg
cacggcagccggccgggcaagggcgaggcgctgtggaagtcgctgcacgtcaccagcggc
gacctgctggtgttcatcgacgccgatctggtcgccttcgacccgcggttcgtcgtcggc
ctgctcggcccgctgctcaccgaccccaccgtcggctacgtcaaggccctttacgaccgg
ccgctgaccaccaccgacggcatcgtcccctccggcggcggccgggtcaccgagctggtc
gcccggccgctgctcaacgccttctggccggagctcgccggcttcgtgcagccgctgtcg
ggcgagtacgccggccgtcgcgagctgctcgagcaggtgccgttcgtctccggctacggc
gtggagctgggcctgctggtcgacctcgcggcgctggccggcctcgacgccctggcccag
gtcgacttcggcacccggcagcacacccaccaggccgacgccgcgctcggccgcatggcc
gggcagatcctgcacaccgcgctggcgcgccggcccggcgccggccgcccgaagcgcgag
ctgctgcagttcctgcgcaccgccgacggcctcgagggcgtcagctgggacgtcggcgtg
gtggagcggccgccgatgcggtcggtccgcgccgtcgagggcggacggagggggcgggcg
tga

DBGET integrated database retrieval system