KEGG   Geodermatophilus obscurus: Gobs_0617Help
Entry
Gobs_0617         CDS       T01163                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00790  Folate biosynthesis
gob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Gobs_0617
Enzymes [BR:gob01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Gobs_0617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI Pyr_redox_2 QueF
Motif
Other DBs
NCBI-ProteinID: ADB73397
UniProt: D2S797
Position
660062..660682
Genome map
AA seq 206 aa AA seqDB search
MSEIPAEAEDLLLSLPRTGVDHVRAAAAVRELLLAVGEDPDRPGLQGTPDRVARAYAETF
AGLWQDPADVLATTFDEDHDEMVLVKDIPMYSTCEHHLVPFHGVAHIGYIPGENGRVTGL
SKLARLVEVYARRPQVQERMTSQIADALADVLKPRGVLVVIEAEHLCMAMRGIRKPGATT
LTSAVRGIFRDNAATRSEAMSLIHGR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagatcccggccgaagccgaggacctgctgctgagcctgccgcggaccggggtc
gaccacgtccgggccgcggccgccgtccgggagctgctgctcgctgtcggcgaggacccc
gaccgtcccggactgcagggcacccccgaccgggtcgcccgcgcgtacgccgagaccttc
gcggggctgtggcaggacccggccgacgtgctggcgaccaccttcgacgaggaccacgac
gagatggtcctggtcaaggacatcccgatgtactcgacctgcgagcaccacctggtcccc
ttccacggggtcgcgcacatcggctacatccccggggagaacgggcgggtcaccggcctg
tccaagctcgcccggctggtcgaggtctacgcccgccgcccgcaggtgcaggagcggatg
accagccagatcgccgacgcgctggccgacgtcctcaagccgcgcggcgtgctggtcgtc
atcgaggccgagcacctgtgcatggccatgcgcggcatccgcaagcccggcgcgacgacg
ctcacctccgccgtgcgcggcatcttccgggacaacgcggcgacccgcagcgaggcgatg
agcctcatccacggccggtga

DBGET integrated database retrieval system