KEGG   Geodermatophilus obscurus: Gobs_1348Help
Entry
Gobs_1348         CDS       T01163                                 

Definition
(GenBank) Methyltransferase type 11
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
gob  Geodermatophilus obscurus
Brite
KEGG Orthology (KO) [BR:gob00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gob03009]
    Gobs_1348
Enzymes [BR:gob01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     Gobs_1348
Ribosome biogenesis [BR:gob03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Gobs_1348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 DNA_ligase_ZBD Methyltransf_11 Methyltransf_2 zf-NADH-PPase Methyltransf_12 OrfB_Zn_ribbon Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: ADB74084
UniProt: D2SBD6
Position
1410487..1411350
Genome map
AA seq 287 aa AA seqDB search
MSRRPWPARAVRLLACPVCGAPLAARPDDAGLRCPAGHSFDRARQGHVTLLPPGHVPPSG
DSAAMVADRVAFLAAGHYAGVTRALADAVAAGDDGPPGALLDLGGGTGQHLAGVLDRLPG
SVGVVLDSSRYAARRAAGAHPRALAVVGDAWARLPVRDAAVNRVLVVFAPRNGPEIARVL
RPGGRLVVVTPAADHLTELVEPLGLLRVDPDKARRLSAALEPQLRPIAASGHRERLELDR
AAVTTLVGMGPHARHLSPAGLAAAVAGLPERTPVTVSVDVTTWIRAG
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgccgtccctggcccgcccgggcggtccggctgctggcctgcccggtgtgcgga
gcgcccctggccgctcggccggacgacgccgggctgcgctgcccggccgggcactcgttc
gaccgcgcgcggcaggggcacgtcacgctgctgccgccggggcacgtcccgccgtccggg
gactccgcggcgatggtcgccgaccgcgtcgccttcctcgccgccggccactacgccggc
gtgacccgtgcgctggcggacgccgtcgccgccggggacgacggtccacccggcgcgctg
ctcgacctcggcgggggcaccgggcagcacctggccggtgtcctcgaccggctgcccggc
tcggtcggggtggtcctggactcctcgcggtacgccgcccgccgcgcggccggcgcgcac
ccgcgggcgctggcggtggtgggggacgcctgggcccggctgccggtgcgcgacgccgcc
gtcaaccgggtgctggtggtcttcgccccgcgcaacggccccgagatcgcacgcgtgctg
cggccgggcgggcggctggtcgtcgtcaccccggccgccgaccacctcaccgagctggtc
gagccgctggggctgctgcgggtcgaccccgacaaggcccgccggctgtcggctgccctc
gagccgcagctgcgcccgatcgccgcgtccgggcaccgggagcggctggagctggaccgc
gcggcggtcacgacgctggtcggcatgggaccgcacgcccgccacctgagcccggcgggc
ctggccgcggcggtggccgggctgcccgagcggacgccggtgaccgtgtcggtggacgtc
acgacctggatccgggccggctga

DBGET integrated database retrieval system