KEGG   Geodermatophilus obscurus: Gobs_1728Help
Entry
Gobs_1728         CDS       T01163                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00330  Arginine and proline metabolism
gob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Gobs_1728
Enzymes [BR:gob01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Gobs_1728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADB74442
UniProt: D2SDI9
Position
complement(1794472..1795428)
Genome map
AA seq 318 aa AA seqDB search
MQEQTPIGPVDATRVPRYAGPATFARLPRIDEVSRADVAVLGVPFDSGVSYRPGARFGPG
HVRAGSKLLRSYNPALDATPFGTQQVADAGDIGVNPFDLGEAIETIDREVTTLRADGAQL
LTIGGDHTIALPILRSLARDHGPVAVLHFDAHLDTWDTYFGAPYTHGTPFRRASEEGLID
VERSLHMGIRGPLYSKQDLEDDAVLGFQVIRSDDYEIDGVRSIVERMRRRLTGGPVYVSV
DIDVLDPAHAPGTGTPEAGGLTSRELLNTLRGLVGLDVVGADIVEVSPPYDHAELTGIAA
AHVGYELLSVLALNRTGG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggagcagaccccgatcggcccggtggacgccacccgtgtcccccgctacgccgga
ccggccaccttcgcccggctgccgcggatcgacgaggtctcccgcgccgacgtcgccgtc
ctcggggtgcccttcgactccggggtcagctaccggcccggcgcccgcttcggccccggg
cacgtgcgggcgggctccaagctgctgcggtcctacaacccggcgctcgacgccacgccc
ttcggcacgcagcaggtggccgacgccggcgacatcggggtcaacccgttcgacctcggc
gaggcgatcgagaccatcgaccgcgaggtgaccacgctgcgcgccgacggcgcccagctg
ctcaccatcggcggggaccacacgatcgcgctgccgatcctgcgctcgctggcgcgtgac
cacggaccggtcgccgtcctgcacttcgacgcccacctcgacacctgggacacctacttc
ggcgccccctacacgcacggcacgccgttccgccgcgccagcgaggaggggctcatcgac
gtggagcgctcgctgcacatgggcatccgcggcccgctgtacagcaagcaggacctcgag
gacgacgccgtcctgggcttccaggtgatccgctccgacgactacgagatcgacggcgtg
cgcagcatcgtcgagcggatgcggcgccggctgaccggcggcccggtctacgtgtcggtc
gacatcgacgtcctcgaccccgcccacgcgccgggcaccgggacgccggaggccggtggc
ctcaccagccgggagctgctcaacacgctgcgcgggctggtcgggctggacgtcgtcggc
gccgacatcgtcgaggtgtccccgccctacgaccacgcggagctgaccggcatcgccgcg
gcccacgtgggctacgagctgctgtcggtcctcgcgctcaaccgcaccggcggctga

DBGET integrated database retrieval system