KEGG   Geodermatophilus obscurus: Gobs_2378Help
Entry
Gobs_2378         CDS       T01163                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00010  Glycolysis / Gluconeogenesis
gob00620  Pyruvate metabolism
gob00640  Propanoate metabolism
gob00680  Methane metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01120  Microbial metabolism in diverse environments
gob01130  Biosynthesis of antibiotics
gob01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Gobs_2378
   00620 Pyruvate metabolism
    Gobs_2378
   00640 Propanoate metabolism
    Gobs_2378
  Energy metabolism
   00680 Methane metabolism
    Gobs_2378
Enzymes [BR:gob01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Gobs_2378
Lipid biosynthesis proteins [BR:gob01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Gobs_2378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADB75052
UniProt: D2S462
Position
2467487..2469190
Genome map
AA seq 567 aa AA seqDB search
MDVTEAYRASRDQLLGLRGRHEQAVAEFRWPELGDRFNWAVDWFDAVARDSDRPALVLVE
EDGTTTRRSYAEMSRASDRLAAWLAGRGVGKGDPVLLMLGNQVELWESMLAVAKLGAVIM
PTTTAVGPADLVDRITRGGARHVVCNAADVATFDEVPGDYTRISVGPAEGWADLHAAADL
EHAPVEHPGTAPGDPLLLYFTSGTTSRPKLVEHTQVSYPVGHLSTVYWLGLQPGDVHLNI
SSPGWAKHAWSCFFAPWIVEATALVYNYRRFDPAALLALVREHGVTSFCAPPTVWRMLIH
ADLSGGPGALREVIGAGEPLNPEVIEQVRRAWGLTIRDGYGQTETTAQIGNTPGSEVKPG
SMGRPLPGVPVVLVDPITGRPVEGPGEGEICLDLAQHPLPLMTGYQGDPERAAEAMAGGY
YHTGDVASVDADGYVTYIGRTDDVFKASDYKISPFELESVLIEHPAVAEAAVVPAPDALR
LAVPKAYVTLAPGHEPTGETALSVLRYAREHLNPYQRVRRIEFAELPKTISGKIRRVELR
AREEELATADPRSGVEWRDDQFPELKS
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaccgaggcctaccgggcgagccgggaccagctgctcgggctgcgcggccgg
cacgagcaggcggtcgccgagttccgctggcccgagctcggggatcggttcaactgggcg
gtcgactggttcgacgccgtcgcccgggacagcgaccgccccgccctggtcctggtcgag
gaggacgggacgacgacgcggcgcagctacgcggagatgtcgcgcgcgtcggaccggctg
gccgcgtggctcgccggccggggcgtcgggaagggcgacccggtgctgctcatgctcggc
aaccaggtcgagctgtgggagtcgatgctcgcggtggcgaagctcggggcggtgatcatg
ccgaccaccaccgcggtcggcccggccgacctggtcgaccggatcacccgcggcggtgcc
cggcacgtcgtctgcaacgcggccgacgtcgcgacgttcgacgaggtccccggcgactac
acccggatcagcgtcgggccggccgagggctgggccgacctgcacgccgccgcggacctc
gagcacgccccggtggagcacccggggaccgcgcccggcgacccgctgctgctgtacttc
acctccgggacgacgtcccgcccgaagctggtcgagcacacccaggtctcctacccggtc
gggcacctgtcgacggtgtactggctgggcctgcagcccggcgacgtgcacctcaacatc
tcctcgccggggtgggccaagcacgcctggtcctgcttcttcgcgccgtggatcgtcgag
gccaccgccctcgtctacaactaccggcgcttcgaccccgccgcgctgctggccctcgtc
cgcgagcacggcgtcacctccttctgcgcgccgcccacggtgtggcggatgctgatccac
gccgacctgtccggcggtcccggcgcgctgcgcgaggtcatcggcgccggcgagccgctc
aacccggaggtcatcgagcaggtgcggcgtgcctgggggctgaccatccgcgacgggtac
ggccagaccgagaccaccgcgcagatcggcaacacgccggggtcggaggtcaagcccggg
tccatgggccgtccgctgcccggcgtgccggtggtgctggtcgacccgatcaccggccgc
ccggtcgaggggccgggggagggggagatctgcctggacctcgcgcagcacccgctcccg
ctgatgaccggctaccagggcgatcccgagcgcgccgctgaggcgatggccggcgggtac
taccacaccggggacgtcgcgagcgtcgacgccgacgggtacgtcacctacatcgggcgc
accgacgacgtcttcaaggccagcgactacaagatcagcccgttcgagctggagtcggtg
ctcatcgagcacccggcggtcgccgaggcagccgtcgtcccggcgccggacgccctgcgg
ctggcggtgcccaaggcctacgtcacgctggctccggggcacgagccgacgggggagacg
gcgctgtcggtgctgcggtacgcccgcgagcacctcaacccctaccagcgggtgcggcgg
atcgagttcgccgagctgcccaagaccatctcggggaagatccggcgggtggagctccgc
gcccgcgaggaggagctcgccaccgccgatccgcgctccggcgtggagtggcgggacgac
cagttccccgagctcaagagctga

DBGET integrated database retrieval system