KEGG   Geodermatophilus obscurus: Gobs_2934Help
Entry
Gobs_2934         CDS       T01163                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00030  Pentose phosphate pathway
gob00480  Glutathione metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01120  Microbial metabolism in diverse environments
gob01130  Biosynthesis of antibiotics
gob01200  Carbon metabolism
Module
gob_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
gob_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:gob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Gobs_2934
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Gobs_2934
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gob04147]
    Gobs_2934
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Gobs_2934
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Gobs_2934
Exosome [BR:gob04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Gobs_2934
  Exosomal proteins of colorectal cancer cells
   Gobs_2934
  Exosomal proteins of bladder cancer cells
   Gobs_2934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ADB75551
UniProt: D2S7U2
Position
complement(3061830..3063185)
Genome map
AA seq 451 aa AA seqDB search
MSRSFVVLGGSGDLTGRLLLPSLARLYDTGVLPEGSELLAVAQEEWDDDAYRSWARDRLA
AHAGDLSRETHERLVDRLRYVQGDVTDAADLRAALARVDGEPVVYLALPHTLFRPTLTAL
AEVGLPEGARVVVEKPFGADQADARALNELLHRLLPEEAVFRVDHFLAKQTVLNILGLRF
ANRVFEPIWNAAHVERVDIVADETLGLEGRAGYYDQAGALRDMVQNHLLQLLAIVAMEPP
LAVDAHSLPARKADVLRAVQPPADVRTGSVRGRYTAGTAAGRALPRYADEEGVDPARQTE
TYAEVTVTVDNWRWAGVPFRLRTGKALGADRQEIVVRFRPVPHLPFLDAEPEPDLLRLSL
SPDAIALEVNLNGAGDPFDLEREVLAARLAPHDLPAYGLLLRELLDGDTTLSISDVEAEE
SWRIVEPVLAAWAASEVPLLDYPAGSAGPAA
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgctcgttcgtcgtcctgggcggctccggcgacctcaccgggcggctgctgctg
ccctcgctggcccggctgtacgacaccggcgtccttccggaggggagcgaactgctcgcc
gtcgcccaggaggagtgggacgacgacgcgtaccggagctgggcccgcgaccggctggcc
gcgcatgccggcgacctgtcgagggagacgcacgaacggctcgtcgaccgcctgcgctac
gtgcagggggatgtcaccgatgccgccgacctgcgcgccgcgctggctcgggtcgacggc
gagccggtggtctacctggccctgccacacaccctcttccgccccacgctcaccgcgctg
gccgaggtcgggctgccggagggcgcacgggtcgtcgtcgagaagccgttcggcgcggac
caggccgacgcccgcgcgctcaacgagctgctgcaccggctgctgcccgaagaggcggtg
ttccgggtcgaccacttcctcgccaagcagacggtgctcaacatcctcggcctgcggttc
gccaaccgggtcttcgagccgatctggaacgccgcccacgtcgagcgcgtcgacatcgtc
gccgacgagaccctcggcctggagggacgggccggctactacgaccaggccggcgccctg
cgcgacatggtgcagaaccacctgctgcagctgctcgcgatcgtggcgatggagccccca
ctggccgtggacgcacactccctgccggcccgcaaggccgacgtgctgcgcgccgtccag
ccaccggccgacgtgcggaccggcagcgtgcgcggcaggtacaccgcggggaccgcggcc
ggccgtgcgctgccgcgctacgccgacgaggagggcgtggacccggcccggcagaccgag
acctacgccgaggtcaccgtgaccgtggacaactggcggtgggccggggtgccgttccgg
ttgcgtaccggcaaggccctgggcgccgaccggcaggagatcgtcgtgcggttccgaccg
gtgccgcacctgccgttcctggacgcggagcccgagcccgacctgctgcggctctcgctg
tcccccgacgccatcgcgctggaggtcaacctcaacggcgcgggggatccgttcgacctc
gaacgggaggtgctcgcggcgcggctggcgccccacgacctgcccgcctacgggctgctg
ctgcgcgagctgctcgacggtgacaccacgctgtcgatcagcgacgtcgaggccgaggag
agctggcgcatcgtcgaaccggtactggccgcctgggccgccagcgaggtgcccctgctg
gactacccggccgggtcggcgggacccgcggcctga

DBGET integrated database retrieval system