KEGG   Geodermatophilus obscurus: Gobs_3043Help
Entry
Gobs_3043         CDS       T01163                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00860  Porphyrin and chlorophyll metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01120  Microbial metabolism in diverse environments
Module
gob_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:gob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gobs_3043
Enzymes [BR:gob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Gobs_3043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ADB75653
UniProt: D2S8S2
Position
3189458..3190588
Genome map
AA seq 376 aa AA seqDB search
MTDVLPEAPPGTEAPLPLAGYTVAVTAARRREELGALLARRGARVVYAPAIRIVPLADDT
ELVAATRQVLAQPVDLVVATTGVGFRGWLEAADAWDLPLVEHLRGARVLARGPKARGAIR
GGGLVDAWSPASESSAEVLEHLLAGAEGPLQGRRIAVQLHGDPLPDFVEALRATGAEVVT
VPVYRWVLPEDVEPVRRLVRSVVTGAVDAVTFTSAPAAASLLTVADELGQRAELIAALTD
GVLPVAVGPVTAGPLTAAGIPSVQPERARLGALAREVVARLPERTPVLRVGERDLQVRGH
AVLLDGRVVELAPGPMAVLRSLAARPGTVVAKADLVAGLPGGGDEHAVEMAVTRLRAALG
RGVVETVVKRGYRLAA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatgtcctgcccgaggccccgccggggaccgaggcaccgctgcccctggccggg
tacaccgtcgcggtgaccgccgcccggcgccgcgaggagctgggtgcgctgctggcccgc
cgcggcgcccgcgtggtgtacgcgccggccatccgcatcgtgccgctggccgacgacacc
gagctggtcgccgcgacgcgccaggtactggcgcagccggtggacctggtcgtggcgacc
accggcgtcggcttccgcgggtggctggaggcggccgacgcgtgggacctgccgctggtg
gagcacctgcgcggcgcccgggtgctcgcgcgcgggcccaaggcgcggggcgccatccgc
ggcggcgggctggtcgacgcctggtcgccggcgtcggagtcctcggccgaggtgctcgag
cacctgctcgccggggccgagggcccgctgcagggacgccgcatcgccgtccagctgcac
ggcgacccgctgccggacttcgtcgaggcgctgcgcgcgaccggcgccgaggtcgtcacc
gtgccggtgtaccgctgggtgctgcccgaggacgtcgagccggtgcgccggctggtgcgc
tcggtggtcaccggcgcggtcgacgcggtgaccttcaccagcgccccggccgccgcgagc
ctgctgaccgtcgccgacgagctcggtcagcgcgccgagctgatcgccgcgctgaccgac
ggcgtcctgccggtggcggtggggccggtgaccgccgggccgctgaccgccgcgggcatc
ccctccgtgcaaccggaacgcgcccggctcggcgccctggcccgcgaggtggtcgcccgg
ctgcccgagcgcaccccggtgctgcgggtgggcgagcgggacctgcaggtgcgcgggcac
gccgtcctgctcgacgggcgggtggtggagctggcgccgggcccgatggcggtgctgcgc
tcgctggccgcgcggccgggcaccgtcgtcgccaaggccgacctcgtcgcggggctgccc
ggcggcggcgacgagcacgccgtggagatggccgtgacccggctgcgcgccgcgctcggc
cgcggcgtggtggagaccgtggtgaagcggggctaccgcctggctgcgtga

DBGET integrated database retrieval system