KEGG   Geodermatophilus obscurus: Gobs_3295Help
Entry
Gobs_3295         CDS       T01163                                 

Definition
(GenBank) CDP-alcohol phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00564  Glycerophospholipid metabolism
gob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Gobs_3295
Enzymes [BR:gob01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     Gobs_3295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf TTSSLRR
Motif
Other DBs
NCBI-ProteinID: ADB75900
UniProt: D2SA85
Position
complement(3467664..3468320)
Genome map
AA seq 218 aa AA seqDB search
MLSREEYLAAWSTWHGGADPTTSRLVHGWLSGVYALARRFAGLPPVAVTAGGLLVAVAAV
VPAAAGGPWLVLAGVLVGFSAVLDGLDGALAIATGRASRRGFVLDSAVDRLGEGAFAAAL
WVAGAPGWLAAAFGALCWLPDYLRARAGQAGVTETGELSVWERPTRVVMTGFTLGGAGVV
AGFGWAGAVVTCGTAVGCLLGVVGVAQLGTALRRALAD
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgctgagccgcgaggagtacctcgccgcctggtcgacgtggcacggcggggccgacccc
acgaccagccggctggtgcacggctggttgtccggggtgtacgcgctggcccgccggttc
gccgggctgccgccggtcgcggtgaccgccggggggctgctcgtcgccgtggccgctgtc
gtcccggccgcggccggcggtccgtggctggtgctcgccggggtgctcgtcgggttctcc
gccgtcctcgacgggttggacggtgcgctcgcgatcgccaccggtcgggcgtcgcgccgc
ggcttcgtcctcgactcggccgtcgaccggctcggcgagggcgcgttcgccgccgcgctg
tgggtcgccggcgcccccggctggctggccgcggcgttcggcgcgctgtgctggctgccg
gactacctgcgcgcccgggccgggcaggccggcgtcaccgagaccggggagctgtcggtc
tgggagcgccccacccgggtggtgatgaccggcttcaccctcggcggggccggggtggtg
gccgggttcgggtgggccggggccgtggtcacctgcgggacggcggtcggctgcctgctc
ggcgtcgtcggcgtcgcccagctcgggacggcgctgaggcgggcgctggccgactga

DBGET integrated database retrieval system