KEGG   Geodermatophilus obscurus: Gobs_4379Help
Entry
Gobs_4379         CDS       T01163                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00053  Ascorbate and aldarate metabolism
gob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Gobs_4379
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     Gobs_4379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD NAD_binding_10 GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NmrA
Motif
Other DBs
NCBI-ProteinID: ADB76935
UniProt: D2SG67
Position
4611217..4612041
Genome map
AA seq 274 aa AA seqDB search
MSGLVLLTGAAGRIGAVLRGGLPERGWALRSLDVVPMADPRPGEEHVVADVTDPAAMAEA
VSGASAVVHLAGVSSESTWAAVSHANIDGTHCVLEAARRAGVPRVVLASSNHATGFTPRP
ASGLLREDDGLPRPDTFYGVSKVAVEALGSLYADRYGLDVVCLRIGTALPEPTTTRHLST
WLSPTDQVSLVDAALRAPSPGFAVVWGVSANSRTWWDLTAARALGYQPADDAEVFAGALV
EVHGEPDLADPVHGRVGGEFTTAEFDAEHFEERA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggtctggtcctgctcaccggggcggccggtcggatcggcgcggtgctgcgcggc
ggcctgccggagcgaggctgggcgctgcgctcgctggacgtcgtcccgatggccgatccc
cgccccggtgaggagcacgtcgtcgcagacgtgaccgacccggccgcgatggccgaggcc
gtctccggcgcctcggccgtcgtccacctggcgggtgtctccagcgagtcgacctgggct
gcggtctcgcacgccaacatcgacggcacccactgcgtgctggaggcggcgcggcgggcc
ggcgtcccccgggtggtgctcgcgtcgagcaaccacgccaccggcttcaccccgcgcccg
gcgtccggtctcctgcgggaggacgacggcctgccgcggccggacaccttctacggggtg
tccaaggtggcggtggaggcgctcggctccctgtacgccgaccggtacggcctggacgtc
gtctgcctgcggatcggcaccgccctccccgagccgacgacgacccgtcacctgtcgacg
tggctctcccccaccgaccaggtgtcgttggtcgacgccgcgctgcgggcgccgtccccc
gggttcgccgtggtgtggggcgtctcggccaacagccgcacctggtgggacctcaccgcc
gcccgcgctctgggctaccagccggccgacgacgcggaggtcttcgccggggcgctggtc
gaggtgcacggcgagcccgacctcgccgatccggtgcacggccgtgtcggcggcgagttc
acgacggccgagttcgacgccgagcacttcgaggagcgtgcgtga

DBGET integrated database retrieval system