KEGG   Geodermatophilus obscurus: Gobs_4575Help
Entry
Gobs_4575         CDS       T01163                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00860  Porphyrin and chlorophyll metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01120  Microbial metabolism in diverse environments
Module
gob_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:gob00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Gobs_4575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gob01007]
    Gobs_4575
Enzymes [BR:gob01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Gobs_4575
Amino acid related enzymes [BR:gob01007]
 Aminotransferase (transaminase)
  Class III
   Gobs_4575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADB77125
UniProt: D2SHH1
Position
complement(4798303..4799688)
Genome map
AA seq 461 aa AA seqDB search
MTSLDSRPYTYEAPASADLFARAQRVTPGGVNSPVRAFGAVGGTPRFMAQGQGAYLTDAD
GRRYVDLVASWGPLILGHAHPAVVEAVTAAARRGLTFGTPTEGEVELAEEILRRMPPVEE
VRLVNSGTEAVLSAVRLARGVTGRRLVVKFAGCYHGHVDALLASAGSGVATLGLPDTPGV
TTGAAADTVVLPYNDAAAVEAVFAERGSEIAAVITEAAVGNMGVVPPLDGFNQALRRTTA
AHGALLIVDEVMTGFRVSRSGWYGLDPVDADLMTFGKVMGGGLPAAAFGGRADLMEHLAP
VGPVYQAGTLSGNPVAVAAGLATLRHCTDEVYARCDEVAVTLRGAASAALFAAGVPHRVQ
QAGSMFSVFFVPDERQVRNYDDARSQDAARYTAFFHAMLARGVYLPPSAFESWFVSAALD
DQAVERVLDALPAAARAAAAVEPATAPPAEEPADARSGMST
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgacctcgctggacagccgcccgtacacctacgaggcccccgcgtcggccgacctcttc
gcccgcgcgcagcgggtcacccccggcggggtgaactccccggtgcgtgccttcggcgcc
gtcggcggcacccctcgcttcatggcgcagggtcagggcgcgtacctcaccgacgccgac
ggccgccgctacgtcgacctcgtcgcctcctgggggccgctgatcctcggccacgcccac
ccggcggtcgtcgaggcggtcaccgccgccgcccgccgcggcctgaccttcggcaccccg
accgagggcgaggtcgagctggccgaggagatcctccgccggatgcccccggtggaggag
gtgcggctggtcaactccggcaccgaggcggtgctctcggcggtgcggctggcccgcggc
gtcaccggccggcggctcgtcgtcaagttcgccggctgctaccacggccacgtcgacgcg
ctgctggcctcggccggctccggcgtggcgaccctcggcctgcccgacacccccggcgtc
accaccggcgccgccgccgacaccgtcgtcctgccctacaacgacgcggccgcggtggag
gccgtcttcgccgagcggggcagcgagatcgccgcggtcatcaccgaggcggcggtcggc
aacatgggcgtcgtcccgccgctggacggcttcaaccaggcgctgcgccgcaccaccgcc
gcgcacggcgcgctgctgatcgtcgacgaggtcatgaccgggttccgggtgtcccgctcc
ggctggtacgggctggacccggtggacgccgacctgatgaccttcggcaaggtcatgggc
ggcgggctgccggccgcggccttcggcggccgcgccgacctcatggagcacctggccccg
gtcgggcccgtctaccaggccggcacgctgtcggggaacccggtcgcggtcgccgcgggc
ctggccacgctgcggcactgcaccgacgaggtgtacgcccgctgcgacgaggtcgccgtc
accctgcgcggggcggccagcgccgcgctgttcgccgccggcgtcccgcaccgcgtgcag
caggccggctcgatgttctcggtgttcttcgtccccgacgagcggcaggtgcgcaactac
gacgacgcccgctcgcaggacgccgcccgctacaccgccttcttccacgcgatgctggcg
cgcggcgtctacctgccgccgtcggcgttcgagtcgtggttcgtcagcgccgcgctcgac
gaccaggccgtcgagcgggtgctcgacgcgctgcccgccgccgcccgggccgcggccgcc
gtcgagccggccaccgccccgccggccgaggagccggccgacgcccgcagcgggatgagc
acctga

DBGET integrated database retrieval system