KEGG   Geodermatophilus obscurus: Gobs_4590Help
Entry
Gobs_4590         CDS       T01163                                 

Definition
(GenBank) pyrroline-5-carboxylate reductase
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00330  Arginine and proline metabolism
gob01100  Metabolic pathways
gob01110  Biosynthesis of secondary metabolites
gob01130  Biosynthesis of antibiotics
gob01230  Biosynthesis of amino acids
Module
gob_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:gob00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Gobs_4590
Enzymes [BR:gob01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     Gobs_4590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored Sacchrp_dh_NADP TrkA_N Shikimate_DH Rossmann-like NAD_binding_2 GFO_IDH_MocA NAD_Gly3P_dh_N YukD IlvN
Motif
Other DBs
NCBI-ProteinID: ADB77139
UniProt: D2S4I9
Position
complement(4812885..4813715)
Genome map
AA seq 276 aa AA seqDB search
MSAGGTGRSGLAIIGGGKIGEALLSGLVRRSGADGIVVCERHPERAAELTARYGVPVLGL
AEAAARARVLLLAVKPQDIGTLLALLAGSVDTGHLVVSVAAGVPTATIEAALPAGVPVVR
VMPNTPALVDEGMSVLSAGAHADEGHLDEAETLLAAVGRVRRVPETQQDAVTALSGSGPA
YFFYLVEAMVDAGILLGLPRDLAVDLIVQTALGSAVMLRDSGEHPVQLREAVTSPGGTTI
AAVRELERHGVRAALIAAIEAAHDRSVELGRAARDR
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccggggggaccggccgctcggggctggcgatcatcggcggcggcaagatcggg
gaggcgctgctctccggcctcgtccgccgcagcggagccgacgggatcgtcgtctgcgag
cggcacccggagcgggccgcggagctgaccgcgcgctacggcgtcccggtgctggggctg
gccgaggccgccgcccgggcgcgggtgctgctgctcgcggtcaagccgcaggacatcggc
acgctgctggcgctcctggcgggctcggtggacaccggtcacctggtggtgtcggtcgcc
gccggcgtcccgacggcgaccatcgaggccgccctgcccgcgggtgtccccgtcgtccgg
gtcatgccgaacacgccggcgctggtcgacgaggggatgagcgtgctctcggccggagcg
cacgccgacgagggtcacctggacgaggcggagacgctgctggccgccgtcgggcgggtg
cggcgggtgccggagacccagcaggacgccgtcacggcgctgtcgggcagcggcccggcc
tacttcttctacctggtcgaggcgatggtcgacgccggcatcctgctgggcctgccgcgc
gacctggccgtggacctcatcgtgcagaccgcgctcggctcggcggtcatgctgcgcgac
tccggtgagcacccggtgcagctgcgggaggcggtcaccagccccggcgggacgacgatc
gccgccgtccgcgagctcgagcggcacggcgtgcgcgcggcgctcatcgccgccatcgag
gcggcgcacgaccgctcggtggagctggggcgggccgcacgcgaccggtga

DBGET integrated database retrieval system